DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lic and Slik

DIOPT Version :9

Sequence 1:NP_477162.1 Gene:lic / 32257 FlyBaseID:FBgn0261524 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_726441.1 Gene:Slik / 37893 FlyBaseID:FBgn0035001 Length:1703 Species:Drosophila melanogaster


Alignment Length:314 Identity:92/314 - (29%)
Similarity:151/314 - (48%) Gaps:37/314 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DID-ADSLEKICDLGRGAYGIVDKMRHKQTDTVLAVKRIPMTVNIREQHRL---VMDLDISMRSS 100
            |.| |:..|.:.:||.||:|.|.|.:||:.....|.|    ...:.::..|   ::::|| :...
  Fly    30 DTDPAEFWEMVGELGDGAFGKVYKAQHKEQKRFAAAK----MCQLEDEENLSDHMVEIDI-LSEI 89

  Fly   101 DCPYTVHFYGAMYREGDVWICMEVM-STSLDKFYPKVFLHDLRMEESVLGKIAMSVVSALHYLHA 164
            ..|..|..|.|...:..:|:.:|.. ..:||....::   :..:.|..:..:...:...|.:||.
  Fly    90 KHPNIVELYEAFSIDDKLWMLIEYCDGGALDSIMVEL---EKPLTEPQIAYVCKHMTEGLTFLHR 151

  Fly   165 QLKVIHRDVKPSNILINRAGQVKICDFGISGYLVDSIAKTIDAGCKPY-MAPERI---DPQGNPA 225
            . ||||||:|..|:|:...|.||:.|||:|.....::.|.......|| ||||.:   ..:.|| 
  Fly   152 N-KVIHRDLKAGNVLLTMEGGVKLADFGVSAKNKHTMQKHDTFIGTPYWMAPELVLCETFRDNP- 214

  Fly   226 QYDIRSDVWSLGIGMIEMATGRYPYDNWRTPFEQLRQVVEDSPPRLPE-GTFSPEFEDFIAVCLQ 289
             ||.:.|:|||||.:||:|. ..|.::..:|...|.::.:..||:|.: ..:|.||.||:...|.
  Fly   215 -YDHKVDIWSLGITLIELAQ-MEPPNSEMSPMRVLLKIQKSEPPKLEQPSRWSKEFNDFLKKSLV 277

  Fly   290 KEYMARPNYEQLLKHSFIVEHLQRNTDI-----------SEFVARILDLPDAQP 332
            |:...||..:.|::|:||    .||.|.           :|.|..::|....:|
  Fly   278 KDPQVRPTTDVLMQHAFI----NRNLDAKPIKDLLLEYKAEVVEEVVDDETEEP 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
licNP_477162.1 PKc_MKK3_6 44..326 CDD:173729 87/301 (29%)
SlikNP_726441.1 STKc_SLK_like 31..310 CDD:132942 87/294 (30%)
S_TKc 37..295 CDD:214567 80/269 (30%)
PKK 958..1095 CDD:289257
PKK 1126..1266 CDD:289257
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.