DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lic and hep

DIOPT Version :9

Sequence 1:NP_477162.1 Gene:lic / 32257 FlyBaseID:FBgn0261524 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001368982.1 Gene:hep / 32256 FlyBaseID:FBgn0010303 Length:1294 Species:Drosophila melanogaster


Alignment Length:304 Identity:138/304 - (45%)
Similarity:186/304 - (61%) Gaps:8/304 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LDSRATIQIGDRTFDIDADSLEKICDLGRGAYGIVDKMRHKQTDTVLAVKRIPMTVNIREQHRLV 90
            ::....:.|..|.:..|.:.|:.:.|||.|..|.|.||.|..::|::|||::..|.|..|..|::
  Fly   177 MEQTGKLNINGRQYPTDINDLKHLGDLGNGTSGNVVKMMHLSSNTIIAVKQMRRTGNAEENKRIL 241

  Fly    91 MDLDISMRSSDCPYTVHFYGAMYREGDVWICMEVMSTSLDKFYPKVFLHDLRMEESVLGKIAMSV 155
            ||||:.::|.||.|.|...|...|:.|||||||:||...||.   :.|....:.|.:|||:.::.
  Fly   242 MDLDVVLKSHDCKYIVKCLGCFVRDPDVWICMELMSMCFDKL---LKLSKKPVPEQILGKVTVAT 303

  Fly   156 VSALHYLHAQLKVIHRDVKPSNILINRAGQVKICDFGISGYLVDSIAKTIDAGCKPYMAPERIDP 220
            |:||.||..:..|||||||||||||:..|.:|:|||||||.||||.|.|..|||..|||||||||
  Fly   304 VNALSYLKDKHGVIHRDVKPSNILIDERGNIKLCDFGISGRLVDSKANTRSAGCAAYMAPERIDP 368

  Fly   221 QGNPAQYDIRSDVWSLGIGMIEMATGRYPYDNWRTPFEQLRQVVEDSPPRLPEG---TFSPEFED 282
            :  ..:||||:|||||||.::|:||.|.||:...|.||.|.:|::..||.||.|   .||.:|.|
  Fly   369 K--KPKYDIRADVWSLGITLVELATARSPYEGCNTDFEVLTKVLDSEPPCLPYGEGYNFSQQFRD 431

  Fly   283 FIAVCLQKEYMARPNYEQLLKHSFIVEHLQRNTDISEFVARILD 326
            |:..||.|.:..||.|.:||...||..:.....|:..:...|.|
  Fly   432 FVIKCLTKNHQDRPKYPELLAQPFIRIYESAKVDVPNWFQSIKD 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
licNP_477162.1 PKc_MKK3_6 44..326 CDD:173729 134/284 (47%)
hepNP_001368982.1 PKc_MKK7 181..476 CDD:270791 138/300 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D108656at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.