DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lic and Map3k4

DIOPT Version :9

Sequence 1:NP_477162.1 Gene:lic / 32257 FlyBaseID:FBgn0261524 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_038966484.1 Gene:Map3k4 / 308106 RGDID:1311192 Length:1599 Species:Rattus norvegicus


Alignment Length:271 Identity:77/271 - (28%)
Similarity:133/271 - (49%) Gaps:33/271 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 LGRGAYGIVDKMRHKQTDTVLAVKRIPMTVNIREQHRLVMDLDISMRSSD---CPYTVHFYGAMY 113
            :|.|.||.|.......|..::|:|.|....|   .|:.:.:....::..:   .|..|.::|...
  Rat  1340 IGEGQYGKVYTCISVDTGELMAMKEIRFQPN---DHKTIKETADELKIFEGIKHPNLVRYFGVEL 1401

  Fly   114 REGDVWICMEVMST-SLDKFYPKVFLHDLRMEESVLGKIAMSVVSALHYLHAQLKVIHRDVKPSN 177
            ...:::|.||.... :|::      :..|.::|.|:...:..:..|::.|| :..::|||:|.:|
  Rat  1402 HREEMYIFMEYCDEGTLEE------VSRLGLQEHVIRLYSKQITVAINVLH-EHGIVHRDIKGAN 1459

  Fly   178 ILINRAGQVKICDFGISGYLVDSIAKTIDA------GCKPYMAPERI-----DPQGNPAQYDIRS 231
            |.:..:|.:|:.|||.|..|.:: |:|:..      |...|||||.|     :..|..|      
  Rat  1460 IFLTSSGLIKLGDFGCSVKLKNN-AQTMPGEVNSTLGTAAYMAPEVITRAKGEGHGRAA------ 1517

  Fly   232 DVWSLGIGMIEMATGRYPYDNWRTPFEQLRQVVEDSPPRLPEGTFSPEFEDFIAVCLQKEYMARP 296
            |:||||..:|||.||:.|:..:...|:.:.:|.....|.:|| ..|||.:||::.||:.:...|.
  Rat  1518 DIWSLGCVVIEMVTGKRPWHEFEHNFQIMYKVGMGHKPPIPE-RLSPEGKDFLSHCLESDPKIRW 1581

  Fly   297 NYEQLLKHSFI 307
            ...|||.|:|:
  Rat  1582 TASQLLDHAFV 1592

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
licNP_477162.1 PKc_MKK3_6 44..326 CDD:173729 77/271 (28%)
Map3k4XP_038966484.1 STKc_MEKK4 1333..1592 CDD:270796 76/269 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339725
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.