DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lic and Map3k3

DIOPT Version :9

Sequence 1:NP_477162.1 Gene:lic / 32257 FlyBaseID:FBgn0261524 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001100528.1 Gene:Map3k3 / 303604 RGDID:1304575 Length:626 Species:Rattus norvegicus


Alignment Length:341 Identity:92/341 - (26%)
Similarity:151/341 - (44%) Gaps:55/341 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KRHRLTPFTIAKEPE----------AAI--VPP----RNLDSRATIQIGDRTFDIDADSLE---- 47
            :||:...||:.....          ||:  :.|    |:.||...:.:.:|:....:.|..    
  Rat   299 RRHQGNLFTLVPSSRSLSTNGENMGAAVQYLDPRGRLRSADSENALTVQERSVPTKSPSAPINWR 363

  Fly    48 --KICDLGRGAYGIVDKMRHKQTDTVLAVKRIPMTVNIREQHRLVMDLDIS---MRSSDCPYTVH 107
              |:  ||:||:|.|.......|...||.|::....:..|..:.|..|:..   :::......|.
  Rat   364 RGKL--LGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNLQHERIVQ 426

  Fly   108 FYGAMYREGD--VWICMEVMSTSLDKFYPKVFLHDLRMEESVLGKIAMSVVSALHYLHAQLKVIH 170
            :||.:....:  :.|.||.|.....|...|.:   ..:.|||..|....::..:.|||:.: ::|
  Rat   427 YYGCLRDRAEKILTIFMEYMPGGSVKDQLKAY---GALTESVTRKYTRQILEGMSYLHSNM-IVH 487

  Fly   171 RDVKPSNILINRAGQVKICDFG---------ISGYLVDSIAKTIDAGCKPY-MAPERIDPQGNPA 225
            ||:|.:|||.:.||.||:.|||         :||..:.|:..|      || |:||.|..:|   
  Rat   488 RDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGMRSVTGT------PYWMSPEVISGEG--- 543

  Fly   226 QYDIRSDVWSLGIGMIEMATGRYPYDNWRTPFEQLRQVVEDSPPRLPEGTFSPEFEDFIAVCLQK 290
             |..::||||||..::||.|.:.|:..:.......:...:.:.|:|| ...|....||:. .:..
  Rat   544 -YGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLP-SHISEHGRDFLR-RIFV 605

  Fly   291 EYMARPNYEQLLKHSF 306
            |...||:.|:||.|.|
  Rat   606 EARQRPSAEELLTHHF 621

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
licNP_477162.1 PKc_MKK3_6 44..326 CDD:173729 81/284 (29%)
Map3k3NP_001100528.1 PB1_Mekk2_3 45..123 CDD:99726
STKc_MEKK3_like 361..621 CDD:270795 79/277 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339726
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.