DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lic and byr1

DIOPT Version :9

Sequence 1:NP_477162.1 Gene:lic / 32257 FlyBaseID:FBgn0261524 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_593026.1 Gene:byr1 / 2542137 PomBaseID:SPAC1D4.13 Length:340 Species:Schizosaccharomyces pombe


Alignment Length:354 Identity:112/354 - (31%)
Similarity:181/354 - (51%) Gaps:51/354 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKRHRLTPFTIAKEPEAAIVPPRNLDSRATIQIGDRTF----------------------DIDA 43
            |.||.| .|..:...|.|::....| |.:..:....::|                      |:|.
pombe     1 MFKRRR-NPKGLVLNPNASVKSSDN-DHKEELINNQKSFESNVEAFMEQCAHMNRRPAWISDLDN 63

  Fly    44 DSLEKICDLGRGAYGIVDKMRHKQTDTVLAVKRIPMTVNIREQHRLVMDLDISMRSSDCPYTVHF 108
            .|||.:..||.|..|.|..::|:  :..:|.|.:.:..:.:.|.:::.:|.: :.....||.|.|
pombe    64 SSLEVVRHLGEGNGGAVSLVKHR--NIFMARKTVYVGSDSKLQKQILRELGV-LHHCRSPYIVGF 125

  Fly   109 YGAMYREGDVWICMEVMST-SLDKFYPKVFLHDLR----MEESVLGKIAMSVVSALHYLHAQLKV 168
            |||...:.::.:|||.|.. |||..        ||    :...:||||..|:|..|.||:..|.:
pombe   126 YGAFQYKNNISLCMEYMDCGSLDAI--------LREGGPIPLDILGKIINSMVKGLIYLYNVLHI 182

  Fly   169 IHRDVKPSNILINRAGQVKICDFGISGYLVDSIAKTIDAGCKPYMAPERIDPQGNPAQYDIRSDV 233
            ||||:||||:::|..|::|:||||:||.||:|:|:|. .|...||:||||    ...:|.::||:
pombe   183 IHRDLKPSNVVVNSRGEIKLCDFGVSGELVNSVAQTF-VGTSTYMSPERI----RGGKYTVKSDI 242

  Fly   234 WSLGIGMIEMATGRYPY-----DNWRTPFEQLRQVVEDSPPRLPEGTFSPEFEDFIAVCLQKEYM 293
            |||||.:||:||...|:     |:.....:.|..:|::.||||| .:|..:...|:..||.|:..
pombe   243 WSLGISIIELATQELPWSFSNIDDSIGILDLLHCIVQEEPPRLP-SSFPEDLRLFVDACLHKDPT 306

  Fly   294 ARPNYEQLLKHSFIVEHLQRNTDISEFVA 322
            .|.:.:||....:..:.|..|.|::.:.:
pombe   307 LRASPQQLCAMPYFQQALMINVDLASWAS 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
licNP_477162.1 PKc_MKK3_6 44..326 CDD:173729 100/289 (35%)
byr1NP_593026.1 PKc_Byr1_like 60..334 CDD:270792 102/290 (35%)
Pkinase 66..320 CDD:278497 96/270 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48013
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2221
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.