DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lic and sek-6

DIOPT Version :9

Sequence 1:NP_477162.1 Gene:lic / 32257 FlyBaseID:FBgn0261524 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_509683.1 Gene:sek-6 / 189074 WormBaseID:WBGene00012162 Length:359 Species:Caenorhabditis elegans


Alignment Length:339 Identity:141/339 - (41%)
Similarity:188/339 - (55%) Gaps:28/339 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PFTIAKEP--------EAAIVPPRNLDSRATIQIGDRTFDIDA-------DSLEKICDLGRGAYG 58
            |..:|..|        :.::.....|.|.:|   |...|..||       .:|..:..:|.|.||
 Worm    15 PVFLANRPTLESLSSNDGSVAEENPLRSMST---GILKFPDDAHLYPFNHTNLRHLSQVGAGYYG 76

  Fly    59 IVDKMRHKQTDTVLAVKRIPMTVNIREQHRLVMDLDISMRSSDCPYTVHFYGAMYREGDVWICME 123
            .|.||:|.::..::|||:|... ||.:|.||:.:.|..|:|.:.|..|.|:||.:.|||.|||||
 Worm    77 TVHKMQHNESGRLIAVKKIRYN-NICDQTRLLKEHDTHMKSENVPNIVKFFGACFSEGDCWICME 140

  Fly   124 VMSTSLDKFYPKVF-LHDLRMEESVLGKIAMSVVSALHYLHAQLKVIHRDVKPSNILINRAGQVK 187
            :|..|:|..|.:|: :...|:.|:::|.|.:.:|.||.||..:|..|||||||||||||.||.||
 Worm   141 LMDISIDFLYKRVYSVKKSRLNENIIGHITVCIVDALDYLKRKLNRIHRDVKPSNILINAAGDVK 205

  Fly   188 ICDFGISGYLVDSIAKTIDAGCKPYMAPERIDPQGNPAQYDIRSDVWSLGIGMIEMATGRYPYDN 252
            :|||||.|.||.|.|.|::|||..|:|||||:   |..:||||||||||||.:.|:|||.|||..
 Worm   206 LCDFGICGDLVGSYAITVEAGCVQYLAPERIE---NMDKYDIRSDVWSLGITLYEIATGVYPYRG 267

  Fly   253 WRTPFEQLRQVVEDSPPRLPEGTFSPEFED----FIAVCLQKEYMARPNYEQLLKHSFIVEHLQR 313
            |....|.:..||....|.|.:...:..:.|    ||..||:|....||.|..|...||...:...
 Worm   268 WSNQMEHIEIVVNGDSPILLQNMHNLHYTDPLCRFINTCLRKNKDDRPKYVNLKTFSFYKMYAVG 332

  Fly   314 NTDISEFVARILDL 327
            ..||.| ..|||.|
 Worm   333 GPDIEE-AKRILGL 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
licNP_477162.1 PKc_MKK3_6 44..326 CDD:173729 129/286 (45%)
sek-6NP_509683.1 PKc_like 57..343 CDD:389743 128/290 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D470057at33208
OrthoFinder 1 1.000 - - FOG0001217
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101822
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.