DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lic and sek-5

DIOPT Version :9

Sequence 1:NP_477162.1 Gene:lic / 32257 FlyBaseID:FBgn0261524 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_508916.3 Gene:sek-5 / 185267 WormBaseID:WBGene00018034 Length:360 Species:Caenorhabditis elegans


Alignment Length:231 Identity:87/231 - (37%)
Similarity:131/231 - (56%) Gaps:10/231 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 RIPMTVNIREQHRL----VMDLDISMRSSDCPYTVHFYG---AMYRE-GDVWICMEVMSTSLDKF 132
            |:|..|:....::|    :.::::....:.||:.|||:|   ..||: ..:.|.||.|:.|....
 Worm    82 RLPKGVDQDSTNKLMAKKLREVNVINGCAPCPFIVHFFGYYVHKYRDCVKIHIFMEEMALSASVL 146

  Fly   133 YPKVFLHDLRMEESVLGKIAMSVVSALHYLHAQLKVIHRDVKPSNILINRAGQVKICDFGISGYL 197
            ..:.......:.|.|:|:|..||:.|:.:|..:|::||||:||.||||:..|:||||||||.|.|
 Worm   147 KTEALKQGGAIPEFVIGRIVCSVIHAMWFLKDRLQIIHRDIKPGNILIDYDGRVKICDFGICGIL 211

  Fly   198 VDSIAKTIDAGCKPYMAPE-RIDPQGNPAQYDIRSDVWSLGIGMIEMATGRYPYDNWRTPFEQLR 261
            .:|||.: |.||:.|.||| .:....|...|.|:||:|||||.:.|:||.||||....:.|..|.
 Worm   212 ENSIAVS-DTGCQQYTAPEILVKGVSNSPGYSIKSDIWSLGITIFELATLRYPYPVGFSEFTLLS 275

  Fly   262 QVVEDSPPRLPEGTFSPEFEDFIAVCLQKEYMARPN 297
            .:|....|.|..||:|....:|::..||.:...||:
 Worm   276 AIVTTPAPYLERGTYSDSLVEFVSKLLQIKEADRPS 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
licNP_477162.1 PKc_MKK3_6 44..326 CDD:173729 87/231 (38%)
sek-5NP_508916.3 PKc_like 58..311 CDD:389743 86/229 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0984
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D688282at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48013
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.