DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lic and mek-1

DIOPT Version :9

Sequence 1:NP_477162.1 Gene:lic / 32257 FlyBaseID:FBgn0261524 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001024771.1 Gene:mek-1 / 181004 WormBaseID:WBGene00003185 Length:347 Species:Caenorhabditis elegans


Alignment Length:309 Identity:131/309 - (42%)
Similarity:196/309 - (63%) Gaps:17/309 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RNLDSRA-------TIQIGDRTFDIDADSLEKICDLGRGAYGIVDKMRHKQTDTVLAVKRIPMTV 81
            :||..:|       |:| |:|. ..|...|:.:.|:|.|:.|.|.|.|:|  ..::|||.:|.|.
 Worm    45 KNLMKQAEENSGYLTLQ-GNRR-KADLKELQFVEDIGHGSCGTVTKCRYK--SVIMAVKTMPRTS 105

  Fly    82 NIREQHRLVMDLDISMRSSDCPYTVHFYGAMYREGDVWICMEVMSTSLDKFYPKVFLHDLRMEES 146
            |..|..|::||||:...|.||||.|..:|......||.:|||.|:|.||:...::   ...:.|.
 Worm   106 NSYEMSRILMDLDVICLSFDCPYIVRCFGYFITNFDVRVCMECMATCLDRLLIRI---KQPIPER 167

  Fly   147 VLGKIAMSVVSALHYLHAQLKVIHRDVKPSNILINRAGQVKICDFGISGYLVDSIAKTIDAGCKP 211
            ::||:::|::.|||||..:.:::||||||||||::.:|.:|:|||||:|.|::|.|.:..|||..
 Worm   168 IIGKLSVSIIKALHYLKTKHQIMHRDVKPSNILLDWSGVIKLCDFGIAGRLIESRAHSKQAGCPL 232

  Fly   212 YMAPERIDPQGNPAQYDIRSDVWSLGIGMIEMATGRYPYDNWRTPFEQLRQVVEDSPPRLPEGTF 276
            ||.|||:|| .|...|||||||||.|:.::|:|||:|||..  |.|:.:.:::.|.||||....|
 Worm   233 YMGPERLDP-NNFDSYDIRSDVWSFGVTLVELATGQYPYAG--TEFDMMSKILNDEPPRLDPAKF 294

  Fly   277 SPEFEDFIAVCLQKEYMARPNYEQLLKHSFIVEHLQRNTDISEFVARIL 325
            ||:|...:..|||::...||||:.||:|.|:|.|.:..||:.|:.|.::
 Worm   295 SPDFCQLVESCLQRDPTMRPNYDMLLQHPFVVHHEKIETDVEEWFADVM 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
licNP_477162.1 PKc_MKK3_6 44..326 CDD:173729 123/282 (44%)
mek-1NP_001024771.1 PKc_MKK7 56..345 CDD:270791 128/298 (43%)
S_TKc 73..325 CDD:214567 115/259 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D470057at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.