DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lic and Nek1

DIOPT Version :9

Sequence 1:NP_477162.1 Gene:lic / 32257 FlyBaseID:FBgn0261524 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001280566.1 Gene:Nek1 / 18004 MGIID:97303 Length:1275 Species:Mus musculus


Alignment Length:305 Identity:68/305 - (22%)
Similarity:139/305 - (45%) Gaps:34/305 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 LEKICDLGRGAYGIVDKMRHKQTDTVLAVKRI---PMTVNIREQHRLVMDLDISMRSSDCPYTVH 107
            |:||   |.|::|....::..:......:|.|   .|:...|::.|..:.:..:|:.   |..|.
Mouse     7 LQKI---GEGSFGKAVLVKSTEDGRHYVIKEINISRMSDKERQESRREVAVLANMKH---PNIVQ 65

  Fly   108 FYGAMYREGDVWICMEVMSTSLDKFYPKVFLHD--LRMEESVLGKIAMSVVSALHYLHAQLKVIH 170
            :..:....|.::|.|:.....  ..:.::....  |..|:.:|... :.:..||.::|.: |::|
Mouse    66 YKESFEENGSLYIVMDYCEGG--DLFKRINAQKGALFQEDQILDWF-VQICLALKHVHDR-KILH 126

  Fly   171 RDVKPSNILINRAGQVKICDFGISGYLVDSI--AKTIDAGCKPYMAPERIDPQGNPAQYDIRSDV 233
            ||:|..||.:.:.|.|::.||||:..|..::  |:|. .|...|::||..:.:    .|:.:||:
Mouse   127 RDIKSQNIFLTKDGTVQLGDFGIARVLNSTVELARTC-IGTPYYLSPEICENK----PYNNKSDI 186

  Fly   234 WSLGIGMIEMATGRYPYDNWRTPFEQLRQVVEDSPPRLPEGTFSPEFEDFIAVCLQKEYMARPNY 298
            |:||..:.|:.|.::.::........|:.:....||..|.  :|.:....::...::....||:.
Mouse   187 WALGCVLYELCTLKHAFEAGNMKNLVLKIISGSFPPVSPH--YSYDLRSLLSQLFKRNPRDRPSV 249

  Fly   299 EQLLKHSFIVEHLQR----NTDISEFVARILD------LPDAQPA 333
            ..:|:..||.:.:::    .....||..:.|.      ||..:||
Mouse   250 NSILEKGFIAKRIEKFLSPQLIAEEFCLKTLSKFGPQPLPGKRPA 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
licNP_477162.1 PKc_MKK3_6 44..326 CDD:173729 63/290 (22%)
Nek1NP_001280566.1 STKc_Nek1 3..258 CDD:270858 59/267 (22%)
S_TKc 4..258 CDD:214567 59/267 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836066
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.