DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lic and mek-2

DIOPT Version :9

Sequence 1:NP_477162.1 Gene:lic / 32257 FlyBaseID:FBgn0261524 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_491087.1 Gene:mek-2 / 171872 WormBaseID:WBGene00003186 Length:387 Species:Caenorhabditis elegans


Alignment Length:339 Identity:107/339 - (31%)
Similarity:174/339 - (51%) Gaps:48/339 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 IQIGDRTFDIDADSLEKICDLGRGAYGIVDKMRHKQTDTVLAVKRIPMTVNIREQHRLVMDLDIS 96
            :|:.:...::..|.|:...:||.|..|:|:|..|::|..::|.|.:.:.:....:.::|.:|.: 
 Worm    59 LQVKEGIKELSEDMLQTEGELGHGNGGVVNKCVHRKTGVIMARKLVHLEIKPSVRQQIVKELAV- 122

  Fly    97 MRSSDCPYTVHFYGAMYREGDVWICMEVM-STSLDKFYPKVFLHDLRMEESVLGKIAMSVVSALH 160
            :...:.|:.|.||||.....|:.||||.| ..|||....||.    |:.|..:|:|:::||..|.
 Worm   123 LHKCNSPFIVGFYGAFVDNNDISICMEYMDGLSLDIVLKKVG----RLPEKFVGRISVAVVRGLT 183

  Fly   161 YLHAQLKVIHRDVKPSNILINRAGQVKICDFGISGYLVDSIAKTIDAGCKPYMAPERIDPQGNPA 225
            ||..::|::||||||||:|:|..|::|:||||:||.|:||:|.:. .|.:.||||||:    ..:
 Worm   184 YLKDEIKILHRDVKPSNMLVNSNGEIKLCDFGVSGMLIDSMANSF-VGTRSYMAPERL----TGS 243

  Fly   226 QYDIRSDVWSLGIGMIEMATGRYPY---------------------------DNWRTP------- 256
            .|.|.||:||.|:.::|:..||||.                           .|:..|       
 Worm   244 HYTISSDIWSFGLSLVELLIGRYPVPAPSQAEYATMFNVAENEIELADSLEEPNYHPPSNPASMA 308

  Fly   257 -FEQLRQVVEDSPPRLPEGTFSPEFEDFIAVCLQKEYMARPNYEQLLKHSFIVEHLQRNT--DIS 318
             ||.|..:|...||.||:..|:.|...|::.||:|....|...:.|....|..::...:.  :.:
 Worm   309 IFEMLDYIVNGPPPTLPKRFFTDEVIGFVSKCLRKLPSERATLKSLTADVFFTQYADHDDQGEFA 373

  Fly   319 EFVARILDLPDAQP 332
            .||...::||...|
 Worm   374 VFVKGTINLPKLNP 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
licNP_477162.1 PKc_MKK3_6 44..326 CDD:173729 103/319 (32%)
mek-2NP_491087.1 PKc_MEK 71..380 CDD:132946 103/318 (32%)
S_TKc 74..360 CDD:214567 98/295 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D688282at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2221
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.