DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lic and Map2k1

DIOPT Version :9

Sequence 1:NP_477162.1 Gene:lic / 32257 FlyBaseID:FBgn0261524 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_113831.1 Gene:Map2k1 / 170851 RGDID:70495 Length:393 Species:Rattus norvegicus


Alignment Length:373 Identity:126/373 - (33%)
Similarity:194/373 - (52%) Gaps:75/373 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KRHRLTPFTIAKEPEAAIVPPRNLDSRATIQIGDRTFDIDADSLEKICDLGRGAYGIVDKMRHKQ 67
            :|.||..|...|:                 ::|    ::..|..|||.:||.|..|:|.|:.||.
  Rat    46 QRKRLEAFLTQKQ-----------------KVG----ELKDDDFEKISELGAGNGGVVFKVSHKP 89

  Fly    68 TDTVLAVKRIPMTVNIREQHRLVMDLDISMRSSDCPYTVHFYGAMYREGDVWICMEVM-STSLDK 131
            :..|:|.|.|.:.:....:::::.:|.: :...:.||.|.||||.|.:|::.||||.| ..|||:
  Rat    90 SGLVMARKLIHLEIKPAIRNQIIRELQV-LHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQ 153

  Fly   132 FYPKVFLHDLRMEESVLGKIAMSVVSALHYLHAQLKVIHRDVKPSNILINRAGQVKICDFGISGY 196
            ...|..    |:.|.:|||::::|:..|.||..:.|::||||||||||:|..|::|:||||:||.
  Rat   154 VLKKAG----RIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQ 214

  Fly   197 LVDSIAKTIDAGCKPYMAPERIDPQGNPAQYDIRSDVWSLGIGMIEMATGRYPY----------- 250
            |:||:|.:. .|.:.||:|||:  ||  ..|.::||:||:|:.::|||.||||.           
  Rat   215 LIDSMANSF-VGTRSYMSPERL--QG--THYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELL 274

  Fly   251 -------DNWRTP-----------------------FEQLRQVVEDSPPRLPEGTFSPEFEDFIA 285
                   |...||                       ||.|..:|.:.||:||.|.||.||:||:.
  Rat   275 FGCQVEGDAAETPPRPRTPGRPLSSYGMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVN 339

  Fly   286 VCLQKEYMARPNYEQLLKHSFIVEHLQRNTDISEFVARILDLPDAQPA 333
            .||.|....|.:.:||:.|:||........|.:.::...:.|  .||:
  Rat   340 KCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGL--NQPS 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
licNP_477162.1 PKc_MKK3_6 44..326 CDD:173729 117/323 (36%)
Map2k1NP_113831.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
PKc_MEK1 62..380 CDD:270816 117/327 (36%)
RAF1-binding 270..307 3/36 (8%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D688282at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.