DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lic and MAP3K2

DIOPT Version :9

Sequence 1:NP_477162.1 Gene:lic / 32257 FlyBaseID:FBgn0261524 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001358839.1 Gene:MAP3K2 / 10746 HGNCID:6854 Length:619 Species:Homo sapiens


Alignment Length:340 Identity:90/340 - (26%)
Similarity:151/340 - (44%) Gaps:61/340 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TPFTIAKEPEAAIVPPRNLDSRATIQIGDRTFDIDADSLEKICD-------------------LG 53
            |..:::....::|..|...|||    |..|..|||..:| .:.|                   ||
Human   304 TDHSLSTSSGSSIFTPEYDDSR----IRRRGSDIDNPTL-TVMDISPPSRSPRAPTNWRLGKLLG 363

  Fly    54 RGAYGIVDKMRHKQTDTVLAVKRIPMTVNIREQHRLVMDLDIS---MRSSDCPYTVHFYGAMY-- 113
            :||:|.|.......|...||||::....:..|..:.|..|:..   :::......|.:||.:.  
Human   364 QGAFGRVYLCYDVDTGRELAVKQVQFDPDSPETSKEVNALECEIQLLKNLLHERIVQYYGCLRDP 428

  Fly   114 REGDVWICMEVMSTSLDKFYPKVFLHDLRMEESVLGKIAMSVVSALHYLHAQLKVIHRDVKPSNI 178
            :|..:.|.||.|.....|...|.:   ..:.|:|..|....::..:||||:.: ::|||:|.:||
Human   429 QEKTLSIFMEYMPGGSIKDQLKAY---GALTENVTRKYTRQILEGVHYLHSNM-IVHRDIKGANI 489

  Fly   179 LINRAGQVKICDFG---------ISGYLVDSIAKTIDAGCKPY-MAPERIDPQGNPAQYDIRSDV 233
            |.:..|.||:.|||         :||..:.|:..|      || |:||.|..:|    |..::|:
Human   490 LRDSTGNVKLGDFGASKRLQTICLSGTGMKSVTGT------PYWMSPEVISGEG----YGRKADI 544

  Fly   234 WSLGIGMIEMATGRYPYDNWRTPFEQLRQVVEDSPPRLPEGTFSPEFEDFIAVCLQK---EYMAR 295
            ||:...::||.|.:.|:..:.......:...:.:.|:||     |...|:....|::   |...|
Human   545 WSVACTVVEMLTEKPPWAEFEAMAAIFKIATQPTNPKLP-----PHVSDYTRDFLKRIFVEAKLR 604

  Fly   296 PNYEQLLKHSFIVEH 310
            |:.::||:|.|:..|
Human   605 PSADELLRHMFVHYH 619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
licNP_477162.1 PKc_MKK3_6 44..326 CDD:173729 79/304 (26%)
MAP3K2NP_001358839.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 25..45
PB1_Mekk2_3 44..122 CDD:99726
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 154..173
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..248
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 289..355 13/55 (24%)
STKc_MEKK2 353..616 CDD:270818 75/281 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145983
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.