DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lic and map3k22

DIOPT Version :9

Sequence 1:NP_477162.1 Gene:lic / 32257 FlyBaseID:FBgn0261524 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_005162724.1 Gene:map3k22 / 100126011 ZFINID:ZDB-GENE-070928-11 Length:624 Species:Danio rerio


Alignment Length:339 Identity:87/339 - (25%)
Similarity:146/339 - (43%) Gaps:73/339 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 AIVPPRNL-----DSRATIQIGDRT--FDIDADSL---EKICD------------------LGRG 55
            :.:|..||     .||.....|:.|  :..|..|:   ||.|.                  ||||
Zfish   305 SFMPQENLFQLVPSSRTRSYNGESTLLYSGDVHSISWTEKNCQRSTPKSPRAPVNWRQGKLLGRG 369

  Fly    56 AYGIVDKMRHKQTDTVLAVKRIPMTVNIREQHRLVMDLDIS---MRSSDCPYTVHFYGAM----Y 113
            |:|:|.......|...||.|::|.....:|..:.|..|:..   :::......|.:||.:    .
Zfish   370 AFGVVYLCYDVDTGRELAAKQVPFDPECQETSKEVNALECEIQLLKNLHHERIVQYYGCLRDPVQ 434

  Fly   114 REGDVWICMEVMSTSLDKFYPKVFLHDL-----RMEESVLGKIAMSVVSALHYLHAQLKVIHRDV 173
            ::..:::          :|.|...:.|.     .:.|.|..:....::..:||||:.: ::|||:
Zfish   435 KKLSIFV----------EFMPGGSIKDQLKAYGALTEKVTRRYTRQILQGVHYLHSNM-IVHRDI 488

  Fly   174 KPSNILINRAGQVKICDFG---------ISGYLVDSIAKTIDAGCKPY-MAPERIDPQGNPAQYD 228
            |.:|||.:.:|.||:.|||         :||..:.|:..|      || |:||.|:.:|    |.
Zfish   489 KGANILRDSSGNVKLGDFGASKRIQTICMSGTGIKSVTGT------PYWMSPEVINGEG----YG 543

  Fly   229 IRSDVWSLGIGMIEMATGRYPYDNWRTPFEQLRQVVEDSPPRLPEGTFSPEFEDFIAVCLQKEYM 293
            .::|:||:...::||.|.:.|:..:.......:...:.:.|.||||. |....||:.....:|..
Zfish   544 RKADIWSVACTVVEMLTQKPPWAEYEAMAAIFKIATQPTKPNLPEGV-SDACRDFLRQIFVEEKW 607

  Fly   294 ARPNYEQLLKHSFI 307
             ||..|.||.|.|:
Zfish   608 -RPTAEGLLSHPFV 620

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
licNP_477162.1 PKc_MKK3_6 44..326 CDD:173729 79/307 (26%)
map3k22XP_005162724.1 PB1_Mekk2_3 62..141 CDD:99726
PKc_like 357..620 CDD:304357 74/285 (26%)
S_TKc 360..620 CDD:214567 74/282 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579514
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.