DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hep and MKK10

DIOPT Version :9

Sequence 1:NP_001368982.1 Gene:hep / 32256 FlyBaseID:FBgn0010303 Length:1294 Species:Drosophila melanogaster
Sequence 2:NP_174510.1 Gene:MKK10 / 840124 AraportID:AT1G32320 Length:305 Species:Arabidopsis thaliana


Alignment Length:393 Identity:107/393 - (27%)
Similarity:162/393 - (41%) Gaps:129/393 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 PPVPHATPFGSASASSSSSSASAFASAAPATGTFGGTYTPPTTRVSRATPTLPMLSSGPGGGLNR 150
            |.:.|.|.|..||:||||...|                                           
plant    19 PLIYHGTAFSVASSSSSSPETS------------------------------------------- 40

  Fly   151 TRPVILPLPTPPHPPVSETDMKLKIIMEQTGKLNINGRQYPTDINDLKHLGDLGNGTSGNVVKMM 215
                  |:.|                                 :|||:.|..||.|:.|.|.|..
plant    41 ------PIQT---------------------------------LNDLEKLSVLGQGSGGTVYKTR 66

  Fly   216 HLSSNTIIAVKQMRRTGNAEENKRILMDLDVVLKSHDCKYIVKCLGCFVRDPDVWICMELM--SM 278
            |..:.|:.|:|.:|    ...|..:.::.| :||..:..:|:||...||...|:...||||  ..
plant    67 HRRTKTLYALKVLR----PNLNTTVTVEAD-ILKRIESSFIIKCYAVFVSLYDLCFVMELMEKGS 126

  Fly   279 CFDKLL--KLSKKPVPEQILGKVTVATVNALSYLKDKHGVIHRDVKPSNILIDERGNIKLCDFGI 341
            ..|.||  ::..:|:...:..::    :..|.||: |.|::|.|:||||:||:::|.:|:.|||.
plant   127 LHDALLAQQVFSEPMVSSLANRI----LQGLRYLQ-KMGIVHGDIKPSNLLINKKGEVKIADFGA 186

  Fly   342 SGRLVDSKANTRSAGCAAYMAPERIDPKK----PKYDIRADVWSLGITLVELATARSPYEGCNTD 402
            | |:| :..:..|.|..|||:|||:|.:|    .:.....||||||:.::|....|.|       
plant   187 S-RIV-AGGDYGSNGTCAYMSPERVDLEKWGFGGEVGFAGDVWSLGVVVLECYIGRYP------- 242

  Fly   403 FEVLTKVLD-------------SEPPCLPYGEGYNFSQQFRDFVIKCLTKNHQDRPKYPELLAQP 454
               ||||.|             :|...:|    .:.|.:|||||.:||.|:.:.|....|||...
plant   243 ---LTKVGDKPDWATLFCAICCNEKVDIP----VSCSLEFRDFVGRCLEKDWRKRDTVEELLRHS 300

  Fly   455 FIR 457
            |::
plant   301 FVK 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hepNP_001368982.1 PKc_MKK7 181..476 CDD:270791 94/298 (32%)
MKK10NP_174510.1 PKc_like 46..305 CDD:419665 94/284 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D688282at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.880

Return to query results.
Submit another query.