DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hep and MKK6

DIOPT Version :9

Sequence 1:NP_001368982.1 Gene:hep / 32256 FlyBaseID:FBgn0010303 Length:1294 Species:Drosophila melanogaster
Sequence 2:NP_200469.1 Gene:MKK6 / 835759 AraportID:AT5G56580 Length:356 Species:Arabidopsis thaliana


Alignment Length:280 Identity:85/280 - (30%)
Similarity:143/280 - (51%) Gaps:16/280 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 DLKHLGDLGNGTSGNVVKMMHLSSNTIIAVKQMRRTGNAEENKRILMDLDVVLKSHDCKYIVKCL 260
            ||:.:..:|.|:.|.|..:.|.......|:|.::.....|..|:|:.:|.:...|..|.::|.|.
plant    69 DLETVKVIGKGSGGVVQLVRHKWVGKFFAMKVIQMNIQEEIRKQIVQELKINQASSQCPHVVVCY 133

  Fly   261 GCFVRDPDVWICMELM--SMCFDKLLKLSKKPVPEQILGKVTVATVNALSYLKDKHGVIHRDVKP 323
            ..|..:....:.:|.|  ....|.:.::  |.:.|..|..|....:..|.||.::..|||||:||
plant   134 HSFYHNGAFSLVLEYMDRGSLADVIRQV--KTILEPYLAVVCKQVLLGLVYLHNERHVIHRDIKP 196

  Fly   324 SNILIDERGNIKLCDFGISGRLVDSKANTRS-AGCAAYMAPERIDPKKPKYDIRADVWSLGITLV 387
            ||:|::.:|.:|:.|||:|..|..|.....: .|...||:||||...  .||..:|:||||::::
plant   197 SNLLVNHKGEVKISDFGVSASLASSMGQRDTFVGTYNYMSPERISGS--TYDYSSDIWSLGMSVL 259

  Fly   388 ELATARSPY------EGCNTDFEVLTKVLDSEPPCLPYGEGYNFSQQFRDFVIKCLTKNHQDRPK 446
            |.|..|.||      :...:.:|:|..::::.||..|..:   ||.:|..||..|:.|:...|..
plant   260 ECAIGRFPYLESEDQQNPPSFYELLAAIVENPPPTAPSDQ---FSPEFCSFVSACIQKDPPARAS 321

  Fly   447 YPELLAQPFIRIYESAKVDV 466
            ..:||:.|||:.:|...:|:
plant   322 SLDLLSHPFIKKFEDKDIDL 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hepNP_001368982.1 PKc_MKK7 181..476 CDD:270791 85/280 (30%)
MKK6NP_200469.1 PKc_MAPKK_plant_like 68..335 CDD:132954 83/272 (31%)
S_TKc 71..331 CDD:214567 79/266 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D688282at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.