DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hep and MKK2

DIOPT Version :9

Sequence 1:NP_001368982.1 Gene:hep / 32256 FlyBaseID:FBgn0010303 Length:1294 Species:Drosophila melanogaster
Sequence 2:NP_001031751.1 Gene:MKK2 / 829103 AraportID:AT4G29810 Length:372 Species:Arabidopsis thaliana


Alignment Length:402 Identity:108/402 - (26%)
Similarity:182/402 - (45%) Gaps:77/402 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 TFGGTYTPPTTRVSRATPTLPMLSSGPGGGLNRTRPVILPLPTPPHPPVSETDMKLKIIMEQTGK 182
            |..||:.....||::....:          :::..|.:|       .|:...|.:|         
plant    36 TQSGTFKDGDLRVNKDGVRI----------ISQLEPEVL-------SPIKPADDQL--------- 74

  Fly   183 LNINGRQYPTDINDLKHLGDLGNGTSGNVVKMMHLSSNTIIAVKQMRRTGNAEENKRILMDLDVV 247
                      .::||..:..:|.|:||.|..:.|..:....|:|.::...:....|.|..:|. :
plant    75 ----------SLSDLDMVKVIGKGSSGVVQLVQHKWTGQFFALKVIQLNIDEAIRKAIAQELK-I 128

  Fly   248 LKSHDCKYIVKCLGCFVRDPDVWICMELM---SMCFDKLLKLSKKPVPEQILGKVTVATVNALSY 309
            .:|..|..:|.....|..:..:.:.:|.|   |:.  ..|| |.|.:|:..|..:....:..|.|
plant   129 NQSSQCPNLVTSYQSFYDNGAISLILEYMDGGSLA--DFLK-SVKAIPDSYLSAIFRQVLQGLIY 190

  Fly   310 LKDKHGVIHRDVKPSNILIDERGNIKLCDFGISGRLVDSK--ANTRSAGCAAYMAPERIDPKKPK 372
            |.....:||||:||||:||:.||.:|:.|||:|..:.::.  ||| ..|...||:||||...  |
plant   191 LHHDRHIIHRDLKPSNLLINHRGEVKITDFGVSTVMTNTAGLANT-FVGTYNYMSPERIVGN--K 252

  Fly   373 YDIRADVWSLGITLVELATARSPYEGCNTD------FEVLTKVLDSEPPCLPYGEGYNFSQQFRD 431
            |..::|:||||:.::|.||.:.||...|.:      ||::..::|..||.||.|   |||.:...
plant   253 YGNKSDIWSLGLVVLECATGKFPYAPPNQEETWTSVFELMEAIVDQPPPALPSG---NFSPELSS 314

  Fly   432 FVIKCLTKNHQDRPKYPELLAQPFIRIYESAKVDVPNWFQSIKDNRLRANGDPTLQRATATGSAI 496
            |:..||.|:...|....||:..||:..|:.:.:::.::|                   |..||.:
plant   315 FISTCLQKDPNSRSSAKELMEHPFLNKYDYSGINLASYF-------------------TDAGSPL 360

  Fly   497 GSGAGSLAGSGS 508
            .: .|:|:|:.|
plant   361 AT-LGNLSGTFS 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hepNP_001368982.1 PKc_MKK7 181..476 CDD:270791 91/305 (30%)
MKK2NP_001031751.1 PKc_MAPKK 77..344 CDD:270782 90/276 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D688282at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.