DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hep and MEK1

DIOPT Version :9

Sequence 1:NP_001368982.1 Gene:hep / 32256 FlyBaseID:FBgn0010303 Length:1294 Species:Drosophila melanogaster
Sequence 2:NP_194337.1 Gene:MEK1 / 828713 AraportID:AT4G26070 Length:354 Species:Arabidopsis thaliana


Alignment Length:364 Identity:108/364 - (29%)
Similarity:178/364 - (48%) Gaps:57/364 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 TFGGTYTPPTTRVSRATPTLPMLSSGPGGGLNRTRPVILPLPTPPHPPVSETDMKLKIIMEQTGK 182
            |..||:.....||::                :..:.|.|..|..| ||:...|.:|.:.      
plant    25 TQSGTFKDGDLRVNK----------------DGIQTVSLSEPGAP-PPIEPLDNQLSLA------ 66

  Fly   183 LNINGRQYPTDINDLKHLGDLGNGTSGNVVKMMHLSSNTIIAVKQMRRTGNAEEN--KRILMDLD 245
                         ||:.:..:|.|:||||..:.|..:....|:|.::.  |.||:  :.|..:|.
plant    67 -------------DLEVIKVIGKGSSGNVQLVKHKLTQQFFALKVIQL--NTEESTCRAISQELR 116

  Fly   246 VVLKSHDCKYIVKCLGCFVRDPDVWICMELM--SMCFDKLLKLSKKPVPEQILGKVTVATVNALS 308
            :.|.| .|.|:|.|...|..:..|.|.:|.|  ....|.|.|:.|  |||.:|..:....:..|.
plant   117 INLSS-QCPYLVSCYQSFYHNGLVSIILEFMDGGSLADLLKKVGK--VPENMLSAICKRVLRGLC 178

  Fly   309 YLKDKHGVIHRDVKPSNILIDERGNIKLCDFGISGRLVDSKANTRS-AGCAAYMAPERIDPKKPK 372
            |:..:..:||||:||||:||:.||.:|:.|||:|..|..:.:...| .|...||:||||...  .
plant   179 YIHHERRIIHRDLKPSNLLINHRGEVKITDFGVSKILTSTSSLANSFVGTYPYMSPERISGS--L 241

  Fly   373 YDIRADVWSLGITLVELATARSPY------EGCNTDFEVLTKVLDSEPPCLPYGEGYNFSQQFRD 431
            |..::|:||||:.|:|.||.:.||      :|.::.:|::..::::.|||.|   ...||.:|..
plant   242 YSNKSDIWSLGLVLLECATGKFPYTPPEHKKGWSSVYELVDAIVENPPPCAP---SNLFSPEFCS 303

  Fly   432 FVIKCLTKNHQDRPKYPELLAQPFIRIYESAKVDVPNWF 470
            |:.:|:.|:.:||....|||...|::::|.:..::..:|
plant   304 FISQCVQKDPRDRKSAKELLEHKFVKMFEDSDTNLSAYF 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hepNP_001368982.1 PKc_MKK7 181..476 CDD:270791 95/301 (32%)
MEK1NP_194337.1 PKc_MAPKK_plant_like 66..332 CDD:132954 93/294 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D688282at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.