DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hep and MKK5

DIOPT Version :9

Sequence 1:NP_001368982.1 Gene:hep / 32256 FlyBaseID:FBgn0010303 Length:1294 Species:Drosophila melanogaster
Sequence 2:NP_001319606.1 Gene:MKK5 / 821676 AraportID:AT3G21220 Length:348 Species:Arabidopsis thaliana


Alignment Length:382 Identity:110/382 - (28%)
Similarity:182/382 - (47%) Gaps:68/382 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 GTYTPPTTRV-SRATPTLPMLSSGPGGGLNRTRPVILPLPTPPHPPVSETDMKLKIIMEQTGKLN 184
            |..:|...|: .|...:||:    |    :|...:.:|||.||....|........|     ..|
plant     9 GVASPMKNRLRKRPDLSLPL----P----HRDVALAVPLPLPPPSSSSSAPASSSAI-----STN 60

  Fly   185 INGRQYPTDINDLKHLGDLGNGTSGNVVKMMHLSSNTIIAVKQMRRTGNAEE--NKRILMDLDVV 247
            |:..:   .:::|:.:..:|:|..|.|.|::|..::...|:|.:  .||.|:  .::|..::: :
plant    61 ISAAK---SLSELERVNRIGSGAGGTVYKVIHTPTSRPFALKVI--YGNHEDTVRRQICREIE-I 119

  Fly   248 LKSHDCKYIVKCLGCFVRDPDVWICMELMSMCFDKLLKLSKKPV-PEQILGKVTVATVNALSYLK 311
            |:|.|...:|||...|..:.::.:.:|.|...     .|....: .||.|..::...::.|:||.
plant   120 LRSVDHPNVVKCHDMFDHNGEIQVLLEFMDQG-----SLEGAHIWQEQELADLSRQILSGLAYLH 179

  Fly   312 DKHGVIHRDVKPSNILIDERGNIKLCDFGISGRLVDS--KANTRSAGCAAYMAPERI--DPKKPK 372
            .:| ::|||:||||:||:...|:|:.|||:|..|..:  ..|: |.|..|||:||||  |....:
plant   180 RRH-IVHRDIKPSNLLINSAKNVKIADFGVSRILAQTMDPCNS-SVGTIAYMSPERINTDLNHGR 242

  Fly   373 YD-IRADVWSLGITLVELATARSPY----EGCNTDF-EVLTKVLDSEPPCLPYGEGYNFSQQFRD 431
            || ...||||||::::|....|.|:    :|   |: .::..:..|:||..|    ...||:||.
plant   243 YDGYAGDVWSLGVSILEFYLGRFPFAVSRQG---DWASLMCAICMSQPPEAP----ATASQEFRH 300

  Fly   432 FVIKCLTKNHQDRPKYPELLAQPFIRIYESAKVDVPNWFQSIKDNRLRANGDPTLQR 488
            ||..||..:...|....:||..|||                     |:|.|.|.|::
plant   301 FVSCCLQSDPPKRWSAQQLLQHPFI---------------------LKATGGPNLRQ 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hepNP_001368982.1 PKc_MKK7 181..476 CDD:270791 90/307 (29%)
MKK5NP_001319606.1 PLN00034 1..342 CDD:215036 110/382 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D688282at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.