DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hep and map2k2a

DIOPT Version :9

Sequence 1:NP_001368982.1 Gene:hep / 32256 FlyBaseID:FBgn0010303 Length:1294 Species:Drosophila melanogaster
Sequence 2:NP_001032468.2 Gene:map2k2a / 563181 ZFINID:ZDB-GENE-041027-1 Length:397 Species:Danio rerio


Alignment Length:404 Identity:132/404 - (32%)
Similarity:199/404 - (49%) Gaps:82/404 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 RTRPVILPLPTPPHPPVSETDM------KLKIIMEQTGKLNINGRQ---------YPTDINDLKH 199
            :.|||  ||...|......|::      .|:.:..:.|:|:::.:|         ....:.:||.
Zfish     4 KRRPV--PLIITPTGEGQSTNIDAAAEANLEALQRKLGELDLDEQQRKRLEAFLTQKAQVGELKD 66

  Fly   200 -----LGDLGNGTSGNVVKMMHLSSNTIIAVKQMRRTGNAEENKRILMDLDVVLKSHDCK--YIV 257
                 :.:||.|..|.|.|:.|..|..::|.|.:..........:|:.:|.|:   |:|.  |||
Zfish    67 EDFEPICELGAGNGGVVHKVRHKPSRLVMARKLIHLEIKPAIRNQIIRELQVL---HECNSPYIV 128

  Fly   258 KCLGCFVRDPDVWICMELM-SMCFDKLLKLSKKPVPEQILGKVTVATVNALSYLKDKHGVIHRDV 321
            ...|.|..|.::.||||.| ....|::||.::: :||:|||||::|.:..|:||::||.::||||
Zfish   129 GFYGAFYSDGEISICMEHMDGGSLDQVLKEARR-IPEEILGKVSIAVLRGLAYLREKHQIMHRDV 192

  Fly   322 KPSNILIDERGNIKLCDFGISGRLVDSKANTRSAGCAAYMAPERIDPKKPKYDIRADVWSLGITL 386
            ||||||::.||.|||||||:||:|:||.||: ..|..:||:|||:  :...|.:::||||:|::|
Zfish   193 KPSNILVNSRGEIKLCDFGVSGQLIDSMANS-FVGTRSYMSPERL--QGTHYSVQSDVWSMGLSL 254

  Fly   387 VELATAR--------------------------------------SPYEGCNTD-------FEVL 406
            ||||..|                                      .|..|...|       ||:|
Zfish   255 VELAIGRYPIPPPDAKELEAIFGRPVLDAGGAEGHSMSPRPRPPGRPVSGHGMDSRPAMAIFELL 319

  Fly   407 TKVLDSEPPCLPYGEGYNFSQQFRDFVIKCLTKNHQDRPKYPELLAQPFIRIYESAKVDVPNWFQ 471
            ..:::..||.||:|.   |:..|.:||.|||.||..||.....|:...||:..|..:||...|. 
Zfish   320 DYIVNEPPPKLPHGV---FTTDFEEFVTKCLIKNPADRADLKMLMGHTFIKRAEVEEVDFAGWL- 380

  Fly   472 SIKDNRLRANGDPT 485
             .|...|.....||
Zfish   381 -CKTMGLHQPSTPT 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hepNP_001368982.1 PKc_MKK7 181..476 CDD:270791 121/356 (34%)
map2k2aNP_001032468.2 PKc_MEK2 63..393 CDD:132980 119/341 (35%)
S_TKc 69..366 CDD:214567 109/306 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D688282at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.