DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hep and MAP2K6

DIOPT Version :9

Sequence 1:NP_001368982.1 Gene:hep / 32256 FlyBaseID:FBgn0010303 Length:1294 Species:Drosophila melanogaster
Sequence 2:XP_011523328.1 Gene:MAP2K6 / 5608 HGNCID:6846 Length:337 Species:Homo sapiens


Alignment Length:332 Identity:144/332 - (43%)
Similarity:205/332 - (61%) Gaps:11/332 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 GLNRTRPVILPLPTPPHPPVSETDMKLKIIMEQTGKLNINGRQYPTDINDLKHLGDLGNGTSGNV 211
            |..|...:.:|......|..|.|..:   .::....::|..:.:....:||:.:.:||.|..|.|
Human     9 GKKRNPGLKIPKEAFEQPQTSSTPPR---DLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVV 70

  Fly   212 VKMMHLSSNTIIAVKQMRRTGNAEENKRILMDLDVVLKSHDCKYIVKCLGCFVRDPDVWICMELM 276
            .||.|:.|..|:|||::|.|.|::|.||:|||||:.:::.||.:.|...|...|:.|||||||||
Human    71 EKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELM 135

  Fly   277 SMCFDKLLK--LSK-KPVPEQILGKVTVATVNALSYLKDKHGVIHRDVKPSNILIDERGNIKLCD 338
            ....||..|  :.| :.:||.||||:.|:.|.||.:|..|..||||||||||:||:..|.:|:||
Human   136 DTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCD 200

  Fly   339 FGISGRLVDSKANTRSAGCAAYMAPERIDPK--KPKYDIRADVWSLGITLVELATARSPYEGCNT 401
            |||||.||||.|.|..|||..|||||||:|:  :..|.:::|:||||||::|||..|.||:...|
Human   201 FGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGT 265

  Fly   402 DFEVLTKVLDSEPPCLPYGEGYNFSQQFRDFVIKCLTKNHQDRPKYPELLAQPFIRIYESAKVDV 466
            .|:.|.:|::...|.||..:   ||.:|.||..:||.||.::||.||||:..||..::||...||
Human   266 PFQQLKQVVEEPSPQLPADK---FSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDV 327

  Fly   467 PNWFQSI 473
            .::.:.|
Human   328 ASFVKLI 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hepNP_001368982.1 PKc_MKK7 181..476 CDD:270791 138/298 (46%)
MAP2K6XP_011523328.1 PKc_MKK3_6 54..336 CDD:173729 137/284 (48%)
S_TKc 57..317 CDD:214567 129/262 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D470057at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.