DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hep and MAP2K3

DIOPT Version :9

Sequence 1:NP_001368982.1 Gene:hep / 32256 FlyBaseID:FBgn0010303 Length:1294 Species:Drosophila melanogaster
Sequence 2:NP_659731.1 Gene:MAP2K3 / 5606 HGNCID:6843 Length:347 Species:Homo sapiens


Alignment Length:322 Identity:143/322 - (44%)
Similarity:198/322 - (61%) Gaps:20/322 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 PLPTPPHPPVSETDMKLKIIMEQTGKLNINGRQYPTDINDLKHLGDLGNGTSGNVVKMMHLSSNT 221
            |.||||....|.|            .:.|..|.:..:.:||..:.:||.|..|.|.|:.|..|.|
Human    36 PNPTPPRNLDSRT------------FITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGT 88

  Fly   222 IIAVKQMRRTGNAEENKRILMDLDVVLKSHDCKYIVKCLGCFVRDPDVWICMELMSMCFDKLLK- 285
            |:|||::|.|.|::|.||:|||||:.:::.||.|.|...|...|:.|||||||||....||..: 
Human    89 IMAVKRIRATVNSQEQKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYRK 153

  Fly   286 -LSKK-PVPEQILGKVTVATVNALSYLKDKHGVIHRDVKPSNILIDERGNIKLCDFGISGRLVDS 348
             |.|. .:||.|||::.|:.|.||.:|..|..||||||||||:||::.|::|:|||||||.||||
Human   154 VLDKNMTIPEDILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDS 218

  Fly   349 KANTRSAGCAAYMAPERIDPK--KPKYDIRADVWSLGITLVELATARSPYEGCNTDFEVLTKVLD 411
            .|.|..|||..|||||||:|:  :..|::::||||||||::|:|..|.|||...|.|:.|.:|::
Human   219 VAKTMDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVE 283

  Fly   412 SEPPCLPYGEGYNFSQQFRDFVIKCLTKNHQDRPKYPELLAQPFIRIYESAKVDVPNWFQSI 473
            ...|.||   ...||.:|.||..:||.||..:|..|.||:..||..::::.|.|:..:.:.|
Human   284 EPSPQLP---ADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEI 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hepNP_001368982.1 PKc_MKK7 181..476 CDD:270791 136/298 (46%)
MAP2K3NP_659731.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..46 5/9 (56%)
PKc_MKK3_6 62..344 CDD:173729 134/284 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D470057at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.