DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hep and sek-4

DIOPT Version :9

Sequence 1:NP_001368982.1 Gene:hep / 32256 FlyBaseID:FBgn0010303 Length:1294 Species:Drosophila melanogaster
Sequence 2:NP_508915.3 Gene:sek-4 / 180811 WormBaseID:WBGene00018035 Length:364 Species:Caenorhabditis elegans


Alignment Length:355 Identity:111/355 - (31%)
Similarity:181/355 - (50%) Gaps:49/355 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 LPLPTPPHPPVSETDMKLKIIMEQ--TGKLNINGRQYPTDIN---DLKHLG-DLGNGTSGNVVKM 214
            :|.|....|.:.||   :..:::.  .|.:.::||    ::|   |:.|.| .:|:|...:.|..
 Worm     8 VPRPKLDLPALRET---IPEVLKNGALGYICLSGR----NLNVPEDMLHGGVRIGSGEGQSAVYR 65

  Fly   215 MHLSSNTIIAVK----QMRRTGNAEENKRI----LMDLDVVLKSHDCKYIVKCLGCFVRD----P 267
            : :.:..:||.|    ::.:.|:.:...::    |.:::|:.....|.:||...|.:|..    .
 Worm    66 L-IYNGMVIARKDVAVRLPQGGDEDSTNKLMAKRLREVNVINGCAPCPFIVHFFGYYVHKYKDCV 129

  Fly   268 DVWICMELMSMCFDKLLKLSKKP---VPEQILGKVTVATVNALSYLKDKHGVIHRDVKPSNILID 329
            .:.|.||.|::....|.|...|.   |||.::|::..:.::|:.:||:|..:||||:||.|||||
 Worm   130 KIHIFMEEMALSASVLKKEVLKRGGIVPEFVIGRIACSVIHAMWFLKEKMQIIHRDIKPGNILID 194

  Fly   330 ERGNIKLCDFGISGRLVDSKANTRSAGCAAYMAPERID---PKKPKYDIRADVWSLGITLVELAT 391
            ..|.:|:|||||||.|.||.| ..:.||..|.|||..:   ...|.|.|::|:||||||:.||||
 Worm   195 YDGRVKICDFGISGILQDSIA-VSATGCQQYTAPEINELAMVHSPGYSIKSDIWSLGITIFELAT 258

  Fly   392 ARSPYEGCNTDFEVLTKVLDSEPPCLPYGEGYNFSQQFRDFVIKCLTKNHQDRPKYPELLAQPFI 456
            ...||....::|.:.:.::.|..|.|..|   .:|....:||.:.|.||..||   |.::|...:
 Worm   259 LTYPYPVGISEFTLSSTIMTSPAPSLERG---IYSDSLVEFVERLLQKNKDDR---PSIVAVQEL 317

  Fly   457 RIYESAKVDVPNWFQSI------KDNRLRA 480
            :.:  .|.|:|  |..|      .||.|.|
 Worm   318 KFF--VKNDIP--FSCIGTGVGDSDNVLNA 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hepNP_001368982.1 PKc_MKK7 181..476 CDD:270791 102/322 (32%)
sek-4NP_508915.3 PKc_like 57..324 CDD:389743 90/276 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.