DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hep and jkk-1

DIOPT Version :9

Sequence 1:NP_001368982.1 Gene:hep / 32256 FlyBaseID:FBgn0010303 Length:1294 Species:Drosophila melanogaster
Sequence 2:NP_001370369.1 Gene:jkk-1 / 180810 WormBaseID:WBGene00002177 Length:435 Species:Caenorhabditis elegans


Alignment Length:342 Identity:129/342 - (37%)
Similarity:196/342 - (57%) Gaps:28/342 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 PLPTPPHPPVSETD---MKLKII--MEQTGKLNINGRQYPTDINDLKHLGDLGNGTSGNVVKMMH 216
            ||...|.|...:|:   ::.:.:  .:::|.|.|:|.:...|.|::..:..||:|:.| ||:...
 Worm    77 PLSMKPSPSRRDTEKDALEYEFLEGYKKSGTLEIDGEKQVVDPNEIHIISLLGSGSCG-VVESAT 140

  Fly   217 LSSNTIIAVKQMRRTGNAEENKRILMDLDVVLKSHDCKYIVKCLGCFVRDPDVWICMELMSMCFD 281
            :.|. ::|||.|.:..|.|..||||.|:. ::...:..:||...|.|:.|..|.|||::||.|.:
 Worm   141 VRSK-LMAVKTMYKNDNKENLKRILRDVR-IMSMCNSPFIVTSYGYFMFDSSVKICMQIMSACCE 203

  Fly   282 KLLKL---SKKP-VPEQILGKVTVATVNALSYLKDKHGVIHRDVKPSNILIDERGNIKLCDFGIS 342
            |||:.   ||.. .||.:.|.:..:.::||.|||:||.:||||:||||||.|:.||:||||||||
 Worm   204 KLLRRIYHSKLDFFPEFVAGHIVYSAISALDYLKEKHSIIHRDIKPSNILFDDSGNVKLCDFGIS 268

  Fly   343 GRLVDSKANTRSAGCAAYMAPERID-PKKPKYDIRADVWSLGITLVELATARSPYEGCNTDFEVL 406
            |.:.||.|:::||||..||||||:. ....|||:|:||||||||:.:|.|...|:...:.:|..|
 Worm   269 GFMTDSMAHSKSAGCPPYMAPERLTIETNSKYDVRSDVWSLGITVYQLVTGLYPFPLNDMEFTTL 333

  Fly   407 TKV--LDSEPPCLPYGEGYNFSQQFRDFVIKCLTKNHQDRPKYPELLAQPFIRIYESAK------ 463
            |.:  |:...|.|......:||..|.:|:..||.|:.::||:|.:|:...|...|:.|.      
 Worm   334 TIIANLNLPSPSLREETKRSFSPLFIEFLDLCLRKDVRERPEYRQLMKHDFYLDYDPASGSAYKF 398

  Fly   464 -------VDVPNWFQSI 473
                   ..|.:||..:
 Worm   399 KAINGKCNQVADWFVDV 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hepNP_001368982.1 PKc_MKK7 181..476 CDD:270791 124/313 (40%)
jkk-1NP_001370369.1 PKc_MKK7 106..418 CDD:270791 124/313 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0983
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1923
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D470057at33208
OrthoFinder 1 1.000 - - FOG0005845
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4836
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.730

Return to query results.
Submit another query.