DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hep and map2k4

DIOPT Version :9

Sequence 1:NP_001368982.1 Gene:hep / 32256 FlyBaseID:FBgn0010303 Length:1294 Species:Drosophila melanogaster
Sequence 2:NP_001107157.1 Gene:map2k4 / 100135013 XenbaseID:XB-GENE-482151 Length:398 Species:Xenopus tropicalis


Alignment Length:315 Identity:162/315 - (51%)
Similarity:208/315 - (66%) Gaps:7/315 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 MEQTGKLNINGRQ-YPTDINDLKHLGDLGNGTSGNVVKMMHLSSNTIIAVKQMRRTGNAEENKRI 240
            :|.:|||.::..| :.....|||.||::|.|..|:|.||.|..|..|:|||::|.|.:.:|.|::
 Frog    80 IESSGKLKLSPEQHWDFTAEDLKDLGEIGRGAYGSVNKMSHTPSGQIMAVKRIRSTVDEKEQKQL 144

  Fly   241 LMDLDVVLKSHDCKYIVKCLGCFVRDPDVWICMELMSMCFDKLLKLSKKP----VPEQILGKVTV 301
            |||||||::|.||.|||:..|...|:.|.|||||||:..|||..|.....    :||:||||:|:
 Frog   145 LMDLDVVMRSSDCPYIVQFYGALFREGDCWICMELMATSFDKFYKYVYSSLDDVIPEEILGKITL 209

  Fly   302 ATVNALSYLKDKHGVIHRDVKPSNILIDERGNIKLCDFGISGRLVDSKANTRSAGCAAYMAPERI 366
            |||.||::||:...:||||:||||||:|..||||||||||||:||||.|.||.|||..|||||||
 Frog   210 ATVKALNHLKENLKIIHRDIKPSNILLDTNGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERI 274

  Fly   367 DPKKPK--YDIRADVWSLGITLVELATARSPYEGCNTDFEVLTKVLDSEPPCLPYGEGYNFSQQF 429
            ||...:  ||:|:|||||||||.||||.|.||...|:.|:.||:|:..:||.|...|...||..|
 Frog   275 DPSASRQGYDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSF 339

  Fly   430 RDFVIKCLTKNHQDRPKYPELLAQPFIRIYESAKVDVPNWFQSIKDNRLRANGDP 484
            ..||.:||||:...||||.|||..|||.:||...|:|..:...|.:....:...|
 Frog   340 ISFVNQCLTKDESKRPKYKELLKHPFILMYEERTVEVAGYVGKILEQMPASPSSP 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hepNP_001368982.1 PKc_MKK7 181..476 CDD:270791 160/301 (53%)
map2k4NP_001107157.1 PKc_MKK4 94..384 CDD:270790 155/289 (54%)
S_TKc 102..366 CDD:214567 147/263 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D470057at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.