DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rad and ralgapa2

DIOPT Version :9

Sequence 1:NP_001285176.1 Gene:rad / 32253 FlyBaseID:FBgn0265597 Length:1799 Species:Drosophila melanogaster
Sequence 2:XP_001920508.2 Gene:ralgapa2 / 568210 ZFINID:ZDB-GENE-131122-56 Length:2015 Species:Danio rerio


Alignment Length:259 Identity:69/259 - (26%)
Similarity:120/259 - (46%) Gaps:34/259 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   862 ELLKLDQVFIKSELKVGVIFVKEDQYTEEQILDNNENSPLFDEFLTLLGDRVRLRGFDKYKGGLD 926
            ||..||....:...|:.|.::.|.|..:..||.|.:.|.::::|::.||..|.|.....:.|||.
Zfish  1724 ELKNLDSRQCRETHKIAVFYIGEGQEDKYSILSNTQGSQVYEDFVSGLGWEVNLATHCGFMGGLQ 1788

  Fly   927 TVHDLTGLFSVYTNWRNIEIMFHVSTLLPYEKHD--PQKLQRKRHIGNDIVCVVFLEADNTR-FS 988
            . :..||..:.|....|:|::|||||.:|.:..|  .:||   ||:|||.|.:|:  :::|| :.
Zfish  1789 R-NGSTGSTAPYYATSNVEVIFHVSTRMPSDSDDSITKKL---RHLGNDEVHIVW--SEHTRDYR 1847

  Fly   989 PACIKSHFLHTFILVRVSARIKHKPTRYEVSVVTRDEVGAYKPYLWEQSVFEKGPMFREWLLTKI 1053
            ...|.:.|....:::     ...|...:.|.::.:.:|..:.| |::.::. .|.:....:....
Zfish  1848 RGIIPTDFGDVLVII-----YPMKNHMFFVQIMKKPQVPFFGP-LFDGAIV-TGELLPSLVRATC 1905

  Fly  1054 VNGERASYS-APKFARMQERTRSQMLEDLVMNLSNHAE-------TGQI--PKPYRRGSWRPIG 1107
            :|..||..| .|.:....|. |:..||.::   .||.|       ..|:  |.|    |:.|.|
Zfish  1906 INASRAVKSRLPLYQSFYEE-RALYLEAII---QNHKENMTFEDFAAQVFSPSP----SYWPSG 1961

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
radNP_001285176.1 LIM <583..623 CDD:259829
Rap_GAP 893..1074 CDD:280332 48/184 (26%)
BTB <1464..1523 CDD:295341
BTB <1467..1526 CDD:197585
BACK 1544..1646 CDD:197943
ralgapa2XP_001920508.2 Rap_GAP 1755..1927 CDD:280332 48/185 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.