DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rad and LOC101884255

DIOPT Version :9

Sequence 1:NP_001285176.1 Gene:rad / 32253 FlyBaseID:FBgn0265597 Length:1799 Species:Drosophila melanogaster
Sequence 2:XP_005174692.3 Gene:LOC101884255 / 101884255 -ID:- Length:288 Species:Danio rerio


Alignment Length:252 Identity:114/252 - (45%)
Similarity:158/252 - (62%) Gaps:9/252 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   843 KEVNLN---PPLTLGQLPDTPEELLKLDQVFIKSELKVGVIFVKEDQYTEEQILDNNENSPLFDE 904
            :|||::   |.|    .|.....::..|:..|.:..|.|||:.|..|.:||::..|||.||.|.|
Zfish     4 EEVNVDRFYPVL----YPKASRLIVTFDEHVISNNFKFGVIYQKFAQTSEEELFGNNEESPAFVE 64

  Fly   905 FLTLLGDRVRLRGFDKYKGGLDTVHDLTGLFSVYTNWRNIEIMFHVSTLLPYEKHDPQKLQRKRH 969
            ||..||:::.|..|..::||||..|..||..|||.|:.|.||||||||.|||.:.|.|:||||||
Zfish    65 FLEFLGEKIDLHDFKGFRGGLDVTHGQTGTESVYVNFHNKEIMFHVSTKLPYTEGDSQQLQRKRH 129

  Fly   970 IGNDIVCVVFLEADNTRFSPACIKSHFLHTFILVRVSARIKHKPTRYEVSVVTRDEVGAYKPYLW 1034
            ||||||.:||.| :||.|.|..|.|:|||.:::|:|....... ..|:|||..||:|..:.|.|.
Zfish   130 IGNDIVAIVFQE-ENTPFVPDMIASNFLHAYVVVQVENACTEN-VLYKVSVTARDDVPFFGPALP 192

  Fly  1035 EQSVFEKGPMFREWLLTKIVNGERASYSAPKFARMQERTRSQMLEDLVMNLSNHAET 1091
            :.:||:|...|.|:||||::|.|.:.|.|.|||:::|||||.:||.|...|..::::
Zfish   193 DPAVFKKSSEFHEFLLTKLINAEYSCYKAEKFAKLEERTRSALLETLYEELHMNSQS 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
radNP_001285176.1 LIM <583..623 CDD:259829
Rap_GAP 893..1074 CDD:280332 91/180 (51%)
BTB <1464..1523 CDD:295341
BTB <1467..1526 CDD:197585
BACK 1544..1646 CDD:197943
LOC101884255XP_005174692.3 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D163377at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.