powered by:
Protein Alignment CG12715 and AT5G48190
DIOPT Version :9
Sequence 1: | NP_001285181.1 |
Gene: | CG12715 / 32252 |
FlyBaseID: | FBgn0030443 |
Length: | 505 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_199630.1 |
Gene: | AT5G48190 / 834872 |
AraportID: | AT5G48190 |
Length: | 102 |
Species: | Arabidopsis thaliana |
Alignment Length: | 49 |
Identity: | 14/49 - (28%) |
Similarity: | 17/49 - (34%) |
Gaps: | 18/49 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 283 LMPNTRRTLAHYTGAGDGFLDLRKFRFPNETADHETFRAMIIEVLLYND 331
|||.:.|.. |:|.|.. .|:|...||.|.|.|
plant 39 LMPMSSRVC--YSGDGPA----------------RTYRKWGIEKLAYRD 69
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4735 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.