DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12715 and AT5G40720

DIOPT Version :9

Sequence 1:NP_001285181.1 Gene:CG12715 / 32252 FlyBaseID:FBgn0030443 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_001330147.1 Gene:AT5G40720 / 834072 AraportID:AT5G40720 Length:583 Species:Arabidopsis thaliana


Alignment Length:407 Identity:81/407 - (19%)
Similarity:129/407 - (31%) Gaps:147/407 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 YGAYYDRRPRIPEMVVLGMAT-------YNGSYPATYLQVW------YDGDN-----------QP 168
            ||....|...:|....:.:|.       ||.....|:...|      .|.||           :|
plant   124 YGRQIVRCSAVPRGNTVSLAVSRWRVDDYNLQVGLTHRWDWLVYDAVIDDDNSTVVFVKGLNLRP 188

  Fly   169 EKL---PVYQSKLGWYKEWGLPEGVVFPTLLTFQMKSQRVPQLVSLVFDPCAVPTNAFKVVPPPP 230
            .|:   ..|:...||        ....|.||   :::|.:.....:|  .|..|....       
plant   189 GKVADASRYECVYGW--------DFTKPKLL---LRAQAISAAQEIV--RCKTPLTVL------- 233

  Fly   231 EEPPNAQ-RPKRIGVCVKYL-RFPDVDMTDRFVEWLELMRLLGATKVT-AFD--IGLLMPNTRRT 290
            :.|..|| :|.::.|.:|.. ..|.|         ...::..|..||: .|:  :..:..|....
plant   234 DGPRRAQSQPVKVSVRIKGSGMLPSV---------AHPIKRPGRIKVSKTFETCVCTMTRNAANV 289

  Fly   291 LAHYTGAGDGFLDLRKFRFPNETADHETFRAMIIEVLLYN-----------------DCLYRNLY 338
            |..:.....|....|.|.:.|.:.|........:|...||                 :|..|...
plant   290 LREWVMYHAGIGVQRWFIYDNNSDDDIVSEIKNLENRGYNISRHFWPWIKTQEAGFANCAIRAKS 354

  Fly   339 DFDFVAVVDVDEVI-MPLGEHRTWQDLLTHLQVQDVNSTTRSS---------------------- 380
            |.|:||.:||||.. :|.|:      .||:: :::..:|..||                      
plant   355 DCDWVAFIDVDEFFYIPSGQ------TLTNV-IRNHTTTPSSSGEIGEIRTPCHSFGPSGLRDPP 412

  Fly   381 -------YCFRNVYFSKQLPVDESIPEQFFMLRH--VIRVAEHLDPYSAIKCLH----------- 425
                   |..|           .::||     ||  :|| .|.|:. :.|..:|           
plant   413 RSGVTAAYTCR-----------MALPE-----RHKSIIR-PESLNA-TLINVVHHFHLKEEFAFV 459

  Fly   426 DTSYVTLLHNHFPFQ-W 441
            |....|::.||:.:| |
plant   460 DVDKSTMVINHYKYQVW 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12715NP_001285181.1 Glyco_transf_92 240..496 CDD:279961 53/267 (20%)
AT5G40720NP_001330147.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.