DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12715 and GALS3

DIOPT Version :9

Sequence 1:NP_001285181.1 Gene:CG12715 / 32252 FlyBaseID:FBgn0030443 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_193750.1 Gene:GALS3 / 827763 AraportID:AT4G20170 Length:504 Species:Arabidopsis thaliana


Alignment Length:425 Identity:80/425 - (18%)
Similarity:141/425 - (33%) Gaps:151/425 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 RPRIPEMVVLGMAT---YNGSYPATYLQVWYDGDNQPEKLPVYQSKLGWYKEWGLPEGVVFPTLL 196
            |..:....|:|:::   :...:| :|...|...|  |.:.|:..:......:||.  |.::.|::
plant   121 RGGVNSFAVIGLSSKPLHVYGHP-SYRCEWVSLD--PTQDPISTTGFKILTDWGY--GRIYTTVV 180

  Fly   197 ---TFQMKSQRVPQ-------LVSLVFDPCAVPTNAFKVVPPPPEEPP----NAQR--------- 238
               ||...|...||       |.:...||....|::..|:..||:...    |:.:         
plant   181 VNCTFSSISAVNPQNSGGTLILHATTGDPTLNLTDSISVLTEPPKSVDFDLYNSTKKTKKYDYLY 245

  Fly   239 ----------PKRIGVCVKY-LRFPDVDMTDRFV----------------EWLELMRLLGATKVT 276
                      |:|:...:.| :||  ......||                .|:||.|      ||
plant   246 CGSSLYGNLSPQRVREWIAYHVRF--FGERSHFVLHDAGGIHEEVFEVLKPWIELGR------VT 302

  Fly   277 AFDIGLLMPNTRRTLAHYTGAGDGFLDLRKFRFPNETADHETFRAMIIEVLLYNDCLYRNLYDFD 341
            ..||        |....:    ||:.             |..|       ::.||||:|..:...
plant   303 LHDI--------RDQERF----DGYY-------------HNQF-------MIVNDCLHRYRFMTK 335

  Fly   342 FVAVVDVDEVIMPLGEHRTWQDLLTHLQVQDVNSTTRSSYCFRNVYFSKQLPVDESI------PE 400
            ::...||||.:              |:.|::..|:...|....:.:..:|:|:...|      |.
plant   336 WMFFFDVDEFL--------------HVPVKETISSVMESLEEYSQFTIEQMPMSSRICYSGDGPA 386

  Fly   401 QFFMLRHVIRVAEHLDPYSAIKCL--HDTSYVTLLHNHFPFQWMNASDPYHVGIDLGQ-MQHYRY 462
            :.:....:.::|     |..:|.:  .|..|.....|.|.           .|:.:.| :|...|
plant   387 RTYRKWGIEKLA-----YRDVKKVPRRDRKYAVQPENVFA-----------TGVHMSQNLQGKTY 435

  Fly   463 TENLKSLVEPPPVRDDNIRRFQHQLIHNSLEVHRQ 497
            .:           .:..||.|.:   |.|:...|:
plant   436 HK-----------AESKIRYFHY---HGSISQRRE 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12715NP_001285181.1 Glyco_transf_92 240..496 CDD:279961 52/281 (19%)
GALS3NP_193750.1 Glyco_transf_92 241..448 CDD:396317 51/290 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.