DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12715 and AT3G27330

DIOPT Version :9

Sequence 1:NP_001285181.1 Gene:CG12715 / 32252 FlyBaseID:FBgn0030443 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_189369.1 Gene:AT3G27330 / 822354 AraportID:AT3G27330 Length:913 Species:Arabidopsis thaliana


Alignment Length:405 Identity:78/405 - (19%)
Similarity:128/405 - (31%) Gaps:131/405 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 YGAYYDRRPRIPEMVVLGMA----TYNGSYPA--TYLQVW--YDG----DN-----------QPE 169
            :|....|.|..|....:.:|    |.:...||  |:...|  ||.    ||           :|.
plant   129 FGGQIVRCPETPRGYTISLAVSRWTTDDHLPAGPTHRYDWLVYDAVIDYDNSTVVFVKGLNLRPG 193

  Fly   170 K---LPVYQSKLGWYKEWGLPEGVVFPTLLTFQMKSQRVPQLVSLVFDPCAVPTNAFKVVPPPPE 231
            :   :..|:...||  ::.....::...::|...:..|           |..|....       :
plant   194 RVADVSRYECVYGW--DFAKHNRLIRSDVITAAQEIVR-----------CRTPLAVL-------D 238

  Fly   232 EPPNAQRPKRIGVCVKYLRFPDVDMTDRFVEWLELMRLLGATKVTAFDIGLLMPNTRRTLA---- 292
            .|..|:.|.::.|.:|       ..|.......:.:|::...:...|.: .:...||...|    
plant   239 GPKAARGPVKVSVRIK-------GGTGMLPSIAQPVRIINPPRKKPFQM-CVCTMTRNAAAVLRE 295

  Fly   293 ---HYTGAGDGFLDLRKFRFPNETADHETFRAMIIEVLLYN-----------------DCLYRNL 337
               ::.|.|    ..|.|.:.|.:.|........:|...||                 :|..|..
plant   296 WVMYHAGIG----VQRWFIYDNNSDDDIIAEIENLERRGYNISRHFWPWIKTQEAGFSNCAIRAK 356

  Fly   338 YDFDFVAVVDVDEVI-MPLGE-------HRTWQDLLTHLQV-------QDVNSTTR----SSYCF 383
            .|.|::|.:||||.. :|.||       :.|..|.:..::.       ..:.|..|    |.|..
plant   357 SDCDWIAFIDVDEFFYIPSGETLTSVIRNYTTTDSIGEIRTPCHSFGPSGLRSRPRSGVTSGYTC 421

  Fly   384 RNVYFSKQLPV-DESIPEQFFMLRHVIRVAEHLDPYSAIKCLHDTSYVTLLHNHFPFQWMNASDP 447
            |.|     ||. .:||.....|...:|.|..|..                |.:.|.|..|:.   
plant   422 RVV-----LPERHKSIIRPEAMNATLINVVHHFH----------------LRDGFTFADMDK--- 462

  Fly   448 YHVGIDLGQMQHYRY 462
                 |:..:.||:|
plant   463 -----DIMVINHYKY 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12715NP_001285181.1 Glyco_transf_92 240..496 CDD:279961 53/267 (20%)
AT3G27330NP_189369.1 Glyco_transf_92 276..486 CDD:279961 49/231 (21%)
RING 724..766 CDD:238093
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.