DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12715 and si:dkey-56i24.1

DIOPT Version :9

Sequence 1:NP_001285181.1 Gene:CG12715 / 32252 FlyBaseID:FBgn0030443 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_001116761.1 Gene:si:dkey-56i24.1 / 568129 ZFINID:ZDB-GENE-081105-8 Length:436 Species:Danio rerio


Alignment Length:283 Identity:68/283 - (24%)
Similarity:120/283 - (42%) Gaps:48/283 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 VCVKYLRFPDVDMTDRFVEWLELMRLLGATKVTAFDIGLLMPNT------RRTLAHYTGAGDGFL 302
            ||:..| |...:...:|.:.:|:.:|||...|..:       ||      ::.|.||  ..:|||
Zfish   170 VCISNL-FGSYNNVLQFAQTMEMYKLLGVQHVVIY-------NTSCGADLKKLLKHY--ESEGFL 224

  Fly   303 D-----LRKFRFPN---ETADHETFRAMIIEVLLYNDCLYRNLYDFDFVAVVDVDEVIMPLGEHR 359
            :     :.||..|:   ...:|:.......:::..|:|:||::|...:|.:.|:||:|||. ::.
Zfish   225 EIVSWPIDKFLNPSPGWNFQEHKGDLHYYGQLVTLNECIYRHMYQSRYVLLNDIDEIIMPY-KYS 288

  Fly   360 TWQDLLTHLQVQDVNSTTRSSYCFRNVYFSKQLPVDESIPEQ--------FFMLRHVIRVAEHLD 416
            ..|.|:..||..|   .:...:...|..|.|....|....::        ..::.|:.|..|..:
Zfish   289 NLQSLMEDLQSAD---PSNGVFLIENHIFPKTQFEDSGKFKREEWKNISGINIMEHIYREPERKN 350

  Fly   417 PYSAIKCLHDTSYV--TLLHNHFPFQWMNASDPYHVGIDLGQMQHYRYTENLKS-LVEPPPVRDD 478
            .|:..|.:.:...|  |.:|:..    .|....|||..::.::.|.|..  |:. |.:.....|.
Zfish   351 VYNPTKMIVNPRKVEQTSVHSSL----KNFGGSYHVPFNVCRIVHVRVP--LQGHLTKEELFVDK 409

  Fly   479 NIRRFQHQLIHNSLEVHRQLAQS 501
            .:..|::.||.|   |.|.|..|
Zfish   410 RVWDFENNLIPN---VDRTLKLS 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12715NP_001285181.1 Glyco_transf_92 240..496 CDD:279961 65/276 (24%)
si:dkey-56i24.1NP_001116761.1 Glyco_transf_92 166..403 CDD:279961 59/252 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.