DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12715 and CG12910

DIOPT Version :9

Sequence 1:NP_001285181.1 Gene:CG12715 / 32252 FlyBaseID:FBgn0030443 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_001260858.1 Gene:CG12910 / 36082 FlyBaseID:FBgn0033502 Length:466 Species:Drosophila melanogaster


Alignment Length:453 Identity:117/453 - (25%)
Similarity:179/453 - (39%) Gaps:86/453 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 RLRADQCAPYPRYEDIEFPNPYFQLTR------HENLSYYLYGAYYDRRPRI-------PEMVVL 144
            |||.| .|...|....|.|||::..:.      :..|.:.:|.||:|.|..|       .|.:.:
  Fly    39 RLRED-LAKAQRQMIFERPNPHWDYSNSWRRIGNSTLRHEIYSAYFDARTDIVGNVRMDDEQMTI 102

  Fly   145 GMATYNGSYP-------ATYLQVWYDGDNQPEKL----PVYQSKLGWYKEWGLPEGVVFPTLLTF 198
            |........|       ...:..:.|..:|..|.    .::......:..|    .::.| |...
  Fly   103 GSLRIFAILPERLRDSSINCIVRFSDFSSQEIKAEEAGAMHDVHNNTFAAW----SIMCP-LHAS 162

  Fly   199 QMKSQRVPQLVSLVFDPCAVPTNAFKVVPPP------PEEPPN---AQRPKRIGVCVKYLRFPDV 254
            :....|:||.|:|     |..:|....:.|.      |....|   ..|| .|.|||..|. .:.
  Fly   163 RRSPLRLPQAVAL-----AYASNRLSHLSPTFIQISYPRNMTNMFGRSRP-TISVCVGPLH-ENY 220

  Fly   255 DMTDRFVEWLELMRLLGATKVTAFDIGLLMPNTRRTLAHYTGAGDGFLDLRKFRFPNETADHETF 319
            ....|.||::|:.||.|||....:.:. ......|.|.||...  |..|:  |.:..:....:..
  Fly   221 SNVLRLVEFVEMYRLQGATHFYFYYVE-ASEEVLRVLEHYQRI--GLADV--FEWNVQAHMQDVH 280

  Fly   320 RAMIIEVLLYNDCLYR-NLYD-FDFVAVVDVDEVIMPLGEHRTWQDLLTHLQVQDVNSTTRSSYC 382
            .|.|  |..:|||:|| |:.| |.:.||||:|||:||| :|.|..|   :|:..|...|  :.:.
  Fly   281 YAGI--VAQFNDCVYRANVVDNFRYAAVVDLDEVVMPL-KHNTLAD---YLRQCDEGRT--AGFV 337

  Fly   383 FRNVYFSKQLPVDESIPEQFFMLRHVI-----------RVAEHLDPYSAIKCLHDTSYVTLLHNH 436
            ||||:|.::   |.:  :.|....||:           |..|.|..|...|.:.:...:..:.||
  Fly   338 FRNVFFHRR---DSN--DTFNAPSHVLNRLLYTQSKVRRTLEVLPAYIRSKVVVNARAIVEMGNH 397

  Fly   437 FPFQWMNASDPYHVGIDLGQMQHYR-YTENLKSLVEPPPVRDDNIRRFQHQLI----HNSLEV 494
            ..::.......:.|...:|.:.||| ...|.|.::    :.|...|||...|.    :..|||
  Fly   398 QVYRAAPGYADHVVHPTVGLLFHYRDKCINCKMVL----IVDYTARRFGSLLFDRVDNTCLEV 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12715NP_001285181.1 Glyco_transf_92 240..496 CDD:279961 79/273 (29%)
CG12910NP_001260858.1 Glyco_transf_92 209..423 CDD:279961 68/232 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.