DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12715 and Y105C5B.25

DIOPT Version :9

Sequence 1:NP_001285181.1 Gene:CG12715 / 32252 FlyBaseID:FBgn0030443 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_502914.1 Gene:Y105C5B.25 / 190901 WormBaseID:WBGene00013662 Length:462 Species:Caenorhabditis elegans


Alignment Length:398 Identity:78/398 - (19%)
Similarity:138/398 - (34%) Gaps:112/398 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 YPRYEDIEFPNPYFQLTRHENLSYYLYGAYYD-RRPRIPEMVVLGMATYNGSYPATYLQVWYDGD 165
            ||.:..|..      :|:| ::...||..||| :|..|.....||..     :|.:.:|.     
 Worm    91 YPDHISITL------ITQH-SIKKQLYCRYYDCKRNEIRGSAWLGTV-----FPESVIQC----- 138

  Fly   166 NQPEKLPVYQSKLGWYKEWGLPEGVVFPTLLTFQMKSQRVPQLVSLVFDPCAVPTNAFKVVPPPP 230
              |.::......:....|   .|..:.|..|||:            ||                 
 Worm   139 --PRRIGAEFVSVSENLE---KESDITPVGLTFR------------VF----------------- 169

  Fly   231 EEPPNAQRPKRIGVCVKYLRFPDVDMTDRFVEWLELMRLLGATKVTA-----FDIGLLMPNTRRT 290
            |||.:     .:.|||       ..|......||.::..:...|:..     |.:|.:....::.
 Worm   170 EEPIH-----ELSVCV-------APMYGNEPSWLPIIDFVEHNKLEGASYFYFYVGEIRDYDQKI 222

  Fly   291 LAHYTGAGDGFLDLRKFRFPNETADHETFRAMIIEVLLYNDCLYRNLYDFDFVAVVDVDEVIMPL 355
            |..|...||  ::|.|.    :...|..|.|.  .:|...||..|:.|...:.|.:|:||.:...
 Worm   223 LDDYVRTGD--IELVKL----QDKYHRVFIAW--HLLQIQDCHLRSAYHSKWTAFIDLDERLSTN 279

  Fly   356 GEHRTWQDLLTHLQVQDVNSTTRSSYCFRNVYFSKQLPVDESIPEQFFMLRHVIRVAEHLDPYSA 420
            |. .|..|:|..:|                         |.|:.|.......:::..::.|.|..
 Worm   280 GP-GTMIDVLRSIQ-------------------------DSSVGEVQLQSTTIVKDQDYPDKYEN 318

  Fly   421 IKCLHDTSYVTLLHNHFPFQWMNASDPYHVGIDLGQMQHYRYTE---NLKSL---VEPPPVRDDN 479
            |:.| :...:...:|....:.|:.:.|......:|.|..::.:.   .:|:|   :....||  :
 Worm   319 IEQL-EQELIFKKYNETVKKTMSGTKPIIKSEKIGLMSIHQASAKYFGVKTLLLNITVASVR--H 380

  Fly   480 IRRFQHQL 487
            :|..:|::
 Worm   381 LRSVKHRI 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12715NP_001285181.1 Glyco_transf_92 240..496 CDD:279961 50/259 (19%)
Y105C5B.25NP_502914.1 Glyco_transf_92 174..419 CDD:366762 50/264 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.