DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12715 and subs-4

DIOPT Version :9

Sequence 1:NP_001285181.1 Gene:CG12715 / 32252 FlyBaseID:FBgn0030443 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_499465.3 Gene:subs-4 / 189978 WormBaseID:WBGene00012939 Length:523 Species:Caenorhabditis elegans


Alignment Length:306 Identity:63/306 - (20%)
Similarity:107/306 - (34%) Gaps:81/306 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 CAVPTNA---FKVVPPP---------PEEPPNAQRPKRIGVCV--KYLRFPDVDMTDRFVEW--- 263
            |.:..:|   ||:...|         ||.|....|...: ||:  .|:          :.:|   
 Worm   131 CDLDVHALKEFKISTTPNVEDAMLITPELPLREPRHDMV-VCMAPMYI----------YTDWEIL 184

  Fly   264 ---LELMRLLGATKVTAFDIGLLMPNTRRTLAHYTGAGDGFLDLR---KFRFPNETADHETFRAM 322
               :||...:||||:.. .:......|.|.|..|  ...|.:.:|   |:...::|..:....:.
 Worm   185 VTGIELWLAMGATKIVV-PVQSASNATYRILQEY--ERKGLVIIRTWPKWPIMSDTNPNGLVLSR 246

  Fly   323 IIEVLLYNDCLYRNLYDFDFVAVVDVDEVIMPL------------------GEHRTWQDLL-THL 368
            .||....| ||:......|.|...|:|:.::||                  .||.....|| .|.
 Worm   247 GIEESHVN-CLFFVKPWSDIVVFSDIDDFLLPLDPSTISPGDNLQILKNIFAEHPQAGSLLFEHR 310

  Fly   369 QVQDVNSTTRSSYCFRNVYF----SKQLPVDESIPEQFFMLRHVIRVAEHLDPYSAIKCLHDTSY 429
            .||.|....:......|..|    |.:..::.::   :.|...|:..|..:|..:    :|:|. 
 Worm   311 DVQFVPPNRQGDQSLTNFNFEFLRSSKNKMNCNV---WRMKTRVVVNASRVDSVN----MHETG- 367

  Fly   430 VTLLHNHFPFQWMNASDPYHVGIDLGQMQHYRYTENLKSLVEPPPV 475
               :|.   |.::....|..    .....|.|::.|  ::..|.|:
 Worm   368 ---IHR---FGYVQTRVPCR----QAHFYHLRHSHN--TVPSPTPI 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12715NP_001285181.1 Glyco_transf_92 240..496 CDD:279961 54/270 (20%)
subs-4NP_499465.3 Glyco_transf_92 166..440 CDD:366762 54/271 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.