DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12715 and T05B11.4

DIOPT Version :9

Sequence 1:NP_001285181.1 Gene:CG12715 / 32252 FlyBaseID:FBgn0030443 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_505002.2 Gene:T05B11.4 / 188111 WormBaseID:WBGene00020247 Length:456 Species:Caenorhabditis elegans


Alignment Length:251 Identity:55/251 - (21%)
Similarity:101/251 - (40%) Gaps:56/251 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 QRPK-RIGVCVKYLRFPDVDMTDRFVEWLELMRLLGAT-------KVTAFDIGLLMPNTRRTLAH 293
            ::|| .:.:||..: :.|......|:|.:|..:|.|..       ..:.:|:        |.:..
 Worm   185 KKPKYELSMCVASI-YGDEPKWLMFIEMIEHFKLQGVQHFYLHIHHASEYDM--------RVIND 240

  Fly   294 YTGAGD---GFLDLRKFRFPNETADHETFRAMIIEVLLYNDCLYRNLYDFDFVAVVDVDEVIMPL 355
            |...|:   .:|..|..|..|..           .::...|||..:..:..:....|:||.|...
 Worm   241 YVRTGEVEVHYLIERDMRADNHW-----------HMVNLADCLIWSRGETKWTIFADLDERIYMT 294

  Fly   356 GEHRTWQDLLTHLQVQDVNSTTRSSYCFRNVYFSKQLPVDESIPEQF--------FMLRHVIRVA 412
            ....|   :|.::||  |.:.:.:|..||..:..|    .|.:|.::        :|..|....:
 Worm   295 NYTGT---ILDYVQV--VKNESIASIQFRQQWIMK----TELMPPKYEGDRQLDKWMPTHRWHSS 350

  Fly   413 EHLDP--YSAIKCLHDTSYVTLLHNHFPFQWM---NASDPYHVGID--LGQMQHYR 461
            ..:.|  ::| ||:.|||.|.::..|:..|:.   |.|:...:.:|  .|.::|||
 Worm   351 SGIGPPGHTA-KCIVDTSKVFIMFIHYVTQFFPATNGSNYVQIRVDPEEGLVRHYR 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12715NP_001285181.1 Glyco_transf_92 240..496 CDD:279961 54/248 (22%)
T05B11.4NP_505002.2 Glyco_transf_92 189..430 CDD:366762 53/247 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.