DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12715 and R07B7.12

DIOPT Version :9

Sequence 1:NP_001285181.1 Gene:CG12715 / 32252 FlyBaseID:FBgn0030443 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_506032.1 Gene:R07B7.12 / 187659 WormBaseID:WBGene00011096 Length:550 Species:Caenorhabditis elegans


Alignment Length:119 Identity:25/119 - (21%)
Similarity:52/119 - (43%) Gaps:23/119 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 DCLYRNLYDFDFVAVVDVDEVIMPLGEHRTWQDLLTHLQVQDVNSTTRSSY-CFRNVYFSKQLPV 394
            |||.:.....:|:|..|:|::::|...|...|:..:|.          ::| .:.::::.|:...
 Worm   293 DCLLQYKEVAEFIAFFDIDDILVPNFSHNYHQEFSSHF----------NAYPSYHSIFYGKRDVF 347

  Fly   395 DESIPE-QFFMLRHVIRVAEHLDPYSAIKCLHDTSYVTLLHNHFPFQ--WMNAS 445
            .|.|.. :.|..||:         :|.:|...:|.|...:.|...:.  |::.|
 Worm   348 VEKISSIEDFSFRHL---------FSNMKIQEETGYGKSIVNPLKYNSTWIHHS 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12715NP_001285181.1 Glyco_transf_92 240..496 CDD:279961 25/119 (21%)
R07B7.12NP_506032.1 Glyco_transf_92 203..455 CDD:279961 25/119 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.