DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12715 and F41D3.8

DIOPT Version :10

Sequence 1:NP_572849.1 Gene:CG12715 / 32252 FlyBaseID:FBgn0030443 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_493097.1 Gene:F41D3.8 / 185608 WormBaseID:WBGene00009613 Length:133 Species:Caenorhabditis elegans


Alignment Length:49 Identity:11/49 - (22%)
Similarity:21/49 - (42%) Gaps:8/49 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   424 LHDTSYVTLLHNHFPFQWMNASDPYHVGIDLGQMQHYRYTENLKSLVEP 472
            ||..|.::.|.:..||:..:...|        ::....|.::|..:.||
 Worm    45 LHQASTLSPLSDSHPFKQKDLDSP--------ELSLLNYEKSLWIIPEP 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12715NP_572849.1 Glyco_transf_92 240..496 CDD:426386 11/49 (22%)
F41D3.8NP_493097.1 None

Return to query results.
Submit another query.