powered by:
Protein Alignment CG12715 and F41D3.8
DIOPT Version :9
Sequence 1: | NP_001285181.1 |
Gene: | CG12715 / 32252 |
FlyBaseID: | FBgn0030443 |
Length: | 505 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_493097.1 |
Gene: | F41D3.8 / 185608 |
WormBaseID: | WBGene00009613 |
Length: | 133 |
Species: | Caenorhabditis elegans |
Alignment Length: | 49 |
Identity: | 11/49 - (22%) |
Similarity: | 21/49 - (42%) |
Gaps: | 8/49 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 424 LHDTSYVTLLHNHFPFQWMNASDPYHVGIDLGQMQHYRYTENLKSLVEP 472
||..|.::.|.:..||:..:...| ::....|.::|..:.||
Worm 45 LHQASTLSPLSDSHPFKQKDLDSP--------ELSLLNYEKSLWIIPEP 85
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG12715 | NP_001285181.1 |
Glyco_transf_92 |
240..496 |
CDD:279961 |
11/49 (22%) |
F41D3.8 | NP_493097.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4735 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.