DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12715 and F39G3.2

DIOPT Version :9

Sequence 1:NP_001285181.1 Gene:CG12715 / 32252 FlyBaseID:FBgn0030443 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_504273.2 Gene:F39G3.2 / 185501 WormBaseID:WBGene00018207 Length:467 Species:Caenorhabditis elegans


Alignment Length:450 Identity:94/450 - (20%)
Similarity:146/450 - (32%) Gaps:151/450 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 ENLSYYLYG-AYYDRRPRIPEMVVLGM--ATYNGSYPATYLQVWYDGDNQPEK------------ 170
            ||.....|. ||.|.|.:||.:.|..|  ...:..|.:..:     |.||.:|            
 Worm    51 ENFPIVFYSTAYLDYRYKIPRLRVFAMNPCVTHKEYMSAEI-----GLNQKKKKVKLRGEPTEGE 110

  Fly   171 LP-------VYQSKLGWYKEWGLPEG--VVFPTLLTFQMKSQRVPQLVSLVFDPCAVPTNAFKVV 226
            .|       .|.|.: |..|.|...|  :|....:|..:.::.:...|..|              
 Worm   111 CPWHWATQCFYNSYI-WTAELGEANGTEMVGIDQITIHLNNRTISLKVQEV-------------- 160

  Fly   227 PPPPEEPPNAQRPKRIG---VCVK----YLRFPDVDMTDRFVEWLELMRLLGATKVTAFDIGLLM 284
                       .|||.|   |||:    |..:.::.:      ::|..|..|.|:...: .....
 Worm   161 -----------HPKRKGGFTVCVQPVYWYSEYHNIAL------FIETWRSQGVTRFIVY-YHSST 207

  Fly   285 PNTRRTLAHYTGAGDGFLDLRKF---------RFPN---ETADHETFRAMIIEVLLYNDCLYR-- 335
            ...|..|.:|...  |.|.||.:         .|||   .:.|..|:|  :...|..|.|...  
 Worm   208 TQVRNLLEYYRNL--GILRLRPWPSFGRLPTRLFPNLKLPSFDSSTYR--VGHTLAQNLCALEMK 268

  Fly   336 ----NLYDFDFVAVVD-------VDEVIMPLGEHRTWQDLLTHLQVQDVNSTTRSSYCFRNVYFS 389
                .:.|||.|.|.|       |:|.:.|                .:|.:.:          ||
 Worm   269 TEIGAIADFDEVMVADKEMLINYVEEAMKP----------------DEVGALS----------FS 307

  Fly   390 KQLPVDESIPEQFFMLRHVIRVAEHLDPYSAIKCLHDTSYVTLLHNHFPFQWMNASDPYHVGIDL 454
            ..|...|  |:...|..|.:.....||.....|.:.::|.|.::..|...:::.........   
 Worm   308 HLLVKFE--PKISTMDFHGVVKPVFLDRNGPPKTIFNSSAVDIIVTHSIRRFIGNETTIRAN--- 367

  Fly   455 GQMQHYR---YTENLKSLVEP-------PPVRDDNIRRFQHQL---------IHNSLEVH 495
            |.:.|||   ||:..|.:.:|       |.:   :|:|.|..|         .:||..:|
 Worm   368 GSLLHYRHNSYTDPAKEVQKPYSLFTSYPNL---HIKRIQKTLRKVFGSSIPPYNSTYLH 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12715NP_001285181.1 Glyco_transf_92 240..496 CDD:279961 65/306 (21%)
F39G3.2NP_504273.2 Glyco_transf_92 167..411 CDD:366762 60/288 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.