DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12715 and F28H7.7

DIOPT Version :9

Sequence 1:NP_001285181.1 Gene:CG12715 / 32252 FlyBaseID:FBgn0030443 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_505744.1 Gene:F28H7.7 / 185098 WormBaseID:WBGene00009240 Length:415 Species:Caenorhabditis elegans


Alignment Length:428 Identity:81/428 - (18%)
Similarity:137/428 - (32%) Gaps:149/428 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 LSYYLYGAYYDRRPRIPEMVVLGMATYNGSYPATYLQVWYDGDNQPEKLPVYQSKLGWYKEWGLP 187
            :.|.:|..|:|:..:..|..:....     || .::.:.....::..|:.:...          |
 Worm    82 IGYTVYCRYFDKNGKEHEKPMKSFI-----YP-LFVVICDRKSSETHKVAITDG----------P 130

  Fly   188 EGVVFPTLLTFQMKSQRVPQLVSLVFDPCAVPTNAFKVVPPPPEEPPNAQRPKRIGVCVKYLRFP 252
            .|||   |..|||...|.......:...|:.|.              ..|.||.:          
 Worm   131 NGVV---LEQFQMIVTRWNASYKRMLTHCSAPL--------------FGQEPKWM---------- 168

  Fly   253 DVDMTDRFVEWLELMRLLGATK-------VTAFDIGLLMPNTRRTLAHYTGAGDGFLDLRKFRFP 310
                  ..||.:|..:|.|.||       :..:|:.:|.        ||....|   ::.....|
 Worm   169 ------HLVEMIEHYKLQGVTKFYFYIREIELYDMSVLQ--------HYMAFRD---EVEIIHIP 216

  Fly   311 NETADHETFRAMIIEVLLYNDCLYRNLYDFDFVAVVDVDEVIMPLGEHRTWQDLLTHLQVQDVNS 375
            :     ..|.|:..:.|...||..||....::....|:||.|:......|.::.|     ||..|
 Worm   217 S-----IYFDAVSQQYLAIADCHLRNQLSANWTIFSDIDERIILTDSKTTIRNFL-----QDSVS 271

  Fly   376 TTRSSYCFRNVYFSKQLPVDESIPEQFFMLRHVIRVAEHL---------DPYSAIKC-------- 423
            .......|...:..|.    |.:||:|.   :.:::.:.:         .|:  :.|        
 Worm   272 EKYGGVMFPQRWIFKY----EKLPEKFI---NPVQIMQEMPSRKWELTTQPW--LNCTDGKHCFS 327

  Fly   424 -------------LHDT-----SYVTLLHNHFPFQWMNASDPYHVGIDLGQMQHYR-------YT 463
                         :||.     :|.||:           .||     .:|.::|||       :.
 Worm   328 KMIVNNQKVLQMMIHDVGEYNGNYQTLI-----------LDP-----KIGYIRHYRDVNMGKWWV 376

  Fly   464 ENLKSLVEPPPVRDDNIR-RFQHQLIHNSLE----VHR 496
            .|...|.:..|..:.... |.:.||:.|.|:    |||
 Worm   377 RNKDVLEKLKPYENTTYNLRLRDQLLTNVLQILYAVHR 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12715NP_001285181.1 Glyco_transf_92 240..496 CDD:279961 58/309 (19%)
F28H7.7NP_505744.1 Glyco_transf_92 151..401 CDD:366762 57/325 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.