DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12715 and E03H4.5

DIOPT Version :9

Sequence 1:NP_001285181.1 Gene:CG12715 / 32252 FlyBaseID:FBgn0030443 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_493148.1 Gene:E03H4.5 / 184020 WormBaseID:WBGene00008473 Length:458 Species:Caenorhabditis elegans


Alignment Length:405 Identity:76/405 - (18%)
Similarity:147/405 - (36%) Gaps:97/405 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 LSYYLYGAYYDRRPRIPEMVVLGMATYNGSYPATYLQVWYDGDNQPEKLPVYQSKLGWYKEWGLP 187
            :.:|.: ||.|.|...|.:.:..:...........:.::|.|...|.||.|:...|    |...|
 Worm    49 IKFYHF-AYVDYRYDSPRLRIFALNPCISKKNFLSVDIFYKGVESPTKLKVFGKSL----EESCP 108

  Fly   188 EG------------VVFPTL--------LTFQMKSQRVPQLVSLVFDPCAVPTNAFKVVPPPPEE 232
            ..            ..|..|        :|..:..::|...|                      |
 Worm   109 SSYEPAKPCFYVAYTFFANLNLNGRLEKVTINLGGRKVNLTV----------------------E 151

  Fly   233 PPNAQRPKRIGVCV----KYLRFPDVDMTDRFVEWLELMRLLGATKVTAFDIGLLMPNTRRTLAH 293
            ..:.:..|.:.:||    .|.::.::      |.::|..|..|.::...| ......:|.:.|.:
 Worm   152 EVHKKVEKGLTMCVLPVYYYSQWQNI------VLYIEAWRAHGTSRFIVF-FHSATKDTWKVLEY 209

  Fly   294 YTGAGDGFLDLRKF----RFPNETADHETFRAMIIEVLLYNDCLYRNLYDFDFV----AVVDVDE 350
            |...  |.:::|.:    ..|:|.||  .:..:...|.:::..|..||...|..    :|.|.||
 Worm   210 YRNL--GIIEIRPWPNFGNLPSEIAD--KYPKIDNSVYIFSYFLALNLCILDIKTTIGSVADFDE 270

  Fly   351 VIMPLGEHRTWQDLLTHLQVQDVNSTTRSSYCFRNVYFSKQLPVDESIPEQFF--MLRHVIRVAE 413
            |::|   |   ...:.....:::..|...:..|:|.|.|    ::.||.:..|  :|:.|.    
 Worm   271 VMVP---H---NGTMLEYASKEMTGTNVGALLFKNSYVS----LEPSIYDNGFSGVLKPVF---- 321

  Fly   414 HLDPYSAIKCLHDTSYVTLLHNHFPFQWMNASDPYHVGIDLGQMQHYRYTENLKSLVEPPPVRDD 478
             ||.....|.:.:.|.:.:...|:...:|:::.  |..:..|.:.|:|:....|        |.:
 Worm   322 -LDGMGPPKYVFNASVIDIGQVHWVRSFMDSTK--HTKVSDGTLLHHRFDAKWK--------RGE 375

  Fly   479 NIRRFQHQLIHNSLE 493
            .:.:......:|:||
 Worm   376 EVEKLFTYFPNNTLE 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12715NP_001285181.1 Glyco_transf_92 240..496 CDD:279961 55/268 (21%)
E03H4.5NP_493148.1 Glyco_transf_92 159..395 CDD:366762 55/268 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.