DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12715 and C18G1.7

DIOPT Version :9

Sequence 1:NP_001285181.1 Gene:CG12715 / 32252 FlyBaseID:FBgn0030443 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_504275.1 Gene:C18G1.7 / 182797 WormBaseID:WBGene00015985 Length:452 Species:Caenorhabditis elegans


Alignment Length:354 Identity:64/354 - (18%)
Similarity:135/354 - (38%) Gaps:61/354 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 AYYDRRPRIPEMVV--LGMATYNGSYPATYLQVWYDGDNQPEKLPVYQSKLGWYKEWGLPEGVVF 192
            ||.|.|...|::.|  |.....|||    :|.:.:: |.:.|.:.:....:.....|.......:
 Worm    47 AYVDLRMSPPKLRVFSLNHCLINGS----FLIIRFE-DYKQENIKMLGEPIEADCPWSWAPNCYY 106

  Fly   193 PTLLTFQMKSQRVP-------QLVSLVFDPCAVPTNAFKVVPPPPEEPPNAQRPKRIGVCVK--- 247
            .:.: |::....||       :.|:::.:...:..|..:|:|         :....:.:||:   
 Worm   107 SSHV-FEVSLYNVPLEELLKIRKVNILINGKVIDLNIKQVMP---------KLKDGLTICVQPVY 161

  Fly   248 -YLRFPDVDMTDRFVEWLELMRLLGATKVTAFDIGLLMPNTRRTLAHYTGAGDGFLDLRKF---- 307
             |.:|.::      :.::|..|..||:....: ........:..|.||...  |.|.:..:    
 Worm   162 WYNQFQNI------ILFIESWRNQGASHFIVY-FHSSTKEVKMVLDHYQKL--GILTIMPWPTFG 217

  Fly   308 ----RFPNETADHETFRAMIIEVLLYNDCLYRNLYDFDFVAVVDVDEVIMPLGEHRTWQDLLTHL 368
                :|||  .:.:.:|  :...|..|.|:..  ......::||.||:|:|...:.:    :..|
 Worm   218 TLPTQFPN--INSQVYR--VGHNLAANLCVLE--MKTTLGSIVDFDELIVPKNGYSS----VLAL 272

  Fly   369 QVQDVNSTTRSSYCFRNVYFSKQLPVDESIPEQFFMLRHVIRVAEHLDPYSAIKCLHDTSYVTLL 433
            .:|.:......:..|.|......|..|::..:...:....:     :|.....|.:..||.:.::
 Worm   273 SIQKLGQENVGALEFENTRVQLDLSNDKTGFDTSSLKNPAL-----VDKKGPPKLIFKTSSIEII 332

  Fly   434 HNHFPFQWMNASDPYHVGIDLGQMQHYRY 462
            ..|...:::..:| ..:.:..|.:.||||
 Worm   333 LTHSVRKFIKTTD-RTLKVAHGTLIHYRY 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12715NP_001285181.1 Glyco_transf_92 240..496 CDD:279961 43/235 (18%)
C18G1.7NP_504275.1 Glyco_transf_92 152..396 CDD:366762 43/234 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.