DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12715 and C18G1.6

DIOPT Version :9

Sequence 1:NP_001285181.1 Gene:CG12715 / 32252 FlyBaseID:FBgn0030443 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_504276.1 Gene:C18G1.6 / 182796 WormBaseID:WBGene00015984 Length:464 Species:Caenorhabditis elegans


Alignment Length:387 Identity:72/387 - (18%)
Similarity:133/387 - (34%) Gaps:109/387 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 YLYGAYYDRRPRIPEMVVLGMATYNGSYPATYLQVWYDGDNQPEKLPVYQSKLGWYKEWGLPE-- 188
            :.:.||.|.|...|.:.:..::..........:.::|:|...|..|.||...|    |...|.  
 Worm    58 FYHNAYVDYRYETPRLRIFALSRCITKKDFLSVDLFYEGIEIPTNLKVYGESL----EGSCPSTY 118

  Fly   189 GVVFPTL------------------LTFQMKSQRVPQLVSLVFDPCAVPTNAFKVVPPPPEEPPN 235
            |...|..                  :|..:.:::|...|..:                      :
 Worm   119 GPAKPCFYVAHTFFANITVTGGLNKVTINLGNRKVNLTVKEI----------------------D 161

  Fly   236 AQRPKRIGVCVK----YLRFPDVDMTDRFVEWLELMRLLGATKVTAFDIGLLMPNTRRTLAHYTG 296
            .:..|.:.:|::    |.::.::      |.::|..:..||::...| ......:|.:.|.:|..
 Worm   162 KRYEKGLTMCLQPVYYYSQWQNI------VLYIEAWKAHGASRFIVF-FHSATKDTWKVLDYYRN 219

  Fly   297 AGDGFLDLRKF----RFPNETADHETFRAMIIEVLLYNDCLYRNLYDFDFV----AVVDVDEVIM 353
            .  |.|::|.:    ..|.:.||  .:..:...|.:::..|..||...|..    .|.|.|||::
 Worm   220 L--GILEIRSWPSFGNLPVQIAD--KYPKIDDSVFIFSYFLAMNLCILDIKTTIGTVADFDEVMV 280

  Fly   354 PLGEHRTWQDLLTHLQVQDVNSTTRSSYCFRNVY--------------FSKQLPVDESIPEQFFM 404
            |  .:.|..|    ..::::..|...:..|.|.|              .|:.:.:|...|.::..
 Worm   281 P--RNGTMLD----YALKEMTGTKVGALSFGNNYVAMEPSIYDNGFSGVSEPVFLDGGGPSKYVF 339

  Fly   405 LRHVIRVAE------HLDPYSAIKCLHDTSYVTLLHNHF----------PFQWMNASDPYHV 450
            ...||.:|:      .|||....|    .|...|||..|          ||.:...:..:||
 Worm   340 NASVIDIAQVHWVKSFLDPTKTTK----GSNGALLHLRFGAKGKKKVKKPFTFFPDNSSHHV 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12715NP_001285181.1 Glyco_transf_92 240..496 CDD:279961 53/253 (21%)
C18G1.6NP_504276.1 Glyco_transf_92 166..408 CDD:366762 53/253 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.