DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12715 and C14C6.8

DIOPT Version :9

Sequence 1:NP_001285181.1 Gene:CG12715 / 32252 FlyBaseID:FBgn0030443 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_503243.3 Gene:C14C6.8 / 182604 WormBaseID:WBGene00015762 Length:498 Species:Caenorhabditis elegans


Alignment Length:284 Identity:74/284 - (26%)
Similarity:113/284 - (39%) Gaps:73/284 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 VSLVFDPCAVPTNAFKVVPPPPEEPPNAQRPKRIG-------VCVKYLRFPDVDMTDRFVEWLEL 266
            |||..|  .:|..:..:||             |||       :|:..| :.|.....:.|:::|.
 Worm   184 VSLTLD--EIPDYSVPIVP-------------RIGNPPHYFTICMAPL-YGDEPKFLQIVDFIEY 232

  Fly   267 MRLLGAT-------KVTAFDIGLLMPNTRRTLAHYTGAGDGFLDLRKFRFPNETADHETFRA--M 322
            .:|.|||       .||.:|        |..|..|...||  :::.|..      || .:||  |
 Worm   233 HKLQGATFFHIYLRNVTDYD--------RMMLDEYVKTGD--IEIIKMH------DH-FWRADYM 280

  Fly   323 IIEVLLYNDCLYRNLYDFDFVAVVDVDEVIMPLGEH-RTWQDLL----------THLQVQDVNST 376
            ..||.: |||.:|:.|...:.|::|:||.:....|. :|..|.|          .|.:|:.|...
 Worm   281 WHEVQI-NDCHHRSKYFSKWTALIDIDERLEIRNEQFKTVVDYLDSIHNASVANLHFRVKWVMKH 344

  Fly   377 TRSSYCFRNVYFSKQLPVDESIPEQFFMLRHVIRVAEHLD-PYSAIKCLHDTSYVTLLHNHFPFQ 440
            ..:...:.|   ..|| .||.:   |...|:..|:.|..| |    ||:.....|.::..|.|..
 Worm   345 NNTPARYEN---DAQL-TDEML---FCKFRNTSRLGELWDQP----KCIIRPENVAIMTIHGPLA 398

  Fly   441 WMNASDPYHVGIDLGQMQHYRYTE 464
            .........|.|::|.::|||..|
 Worm   399 MYKGETITLVNINIGFIRHYRSVE 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12715NP_001285181.1 Glyco_transf_92 240..496 CDD:279961 67/253 (26%)
C14C6.8NP_503243.3 Glyco_transf_92 207..452 CDD:366762 64/246 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.