DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12715 and C01G5.9

DIOPT Version :9

Sequence 1:NP_001285181.1 Gene:CG12715 / 32252 FlyBaseID:FBgn0030443 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_500991.2 Gene:C01G5.9 / 182076 WormBaseID:WBGene00015311 Length:426 Species:Caenorhabditis elegans


Alignment Length:328 Identity:66/328 - (20%)
Similarity:115/328 - (35%) Gaps:91/328 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 DNQPEKLPVYQSKLGWYKEWGLPEGVVFPTLLTFQMKSQRV-PQLVSLVFDPCAVPTNAFKVVPP 228
            :|:.|   :||..:           .|||.|.....:|..| .:.|::..:...||.|..::.  
 Worm   117 ENRQE---IYQKAV-----------AVFPELTIKCSESSSVKAEFVAVTINKKDVPGNMKQIY-- 165

  Fly   229 PPEEPPNAQRPKRIGVCVK--YLRFPDVDMTDRFVEWLELMRLLGATK--VTAFDIGLLMPNTRR 289
               :....:......||:.  |...|.|.|   .:|::|..:|.||..  :.:|:|.   ..|..
 Worm   166 ---KEKETKNKSEFTVCLAPLYGESPKVLM---LMEFIEYYKLQGADHFLIYSFNIS---KETEN 221

  Fly   290 TLAHYTGAGDGFLDLRKFRFPNET-------ADHETFRAMIIEVLLYNDCLYRNLYDFDFVAVVD 347
            .|..|..:.    :|...:..|||       ..||         :...||::|......:||.||
 Worm   222 VLDFYRNSS----NLEVIQMGNETKCLNRHRCRHE---------MQLQDCVFRTQKYSSWVATVD 273

  Fly   348 VDEVIMPLGEHRTWQDLLTHLQVQDVNSTT-RSSYCFRNVYFSKQLPVDESIPEQFFMLRHVIRV 411
            :||.||.:.|..|..|.:.:.....::... |..:..|....|...|..|::|            
 Worm   274 LDERIMMIDEKSTLLDYIRNCNDHKISELRFRCQWTLRYSEISSGAPQIENLP------------ 326

  Fly   412 AEHLDPYSAIKCLHDTSYVTLLHNHFPFQWMNASDPYHVGI------------------DLGQMQ 458
                     :...|:||:|. ..||.....:.:.:...:|:                  ::..::
 Worm   327 ---------MITWHNTSHVA-PQNHTTKSIIRSRNVDSMGVHGVQKFRNPIYGVRLVEPEIAVVR 381

  Fly   459 HYR 461
            |||
 Worm   382 HYR 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12715NP_001285181.1 Glyco_transf_92 240..496 CDD:279961 52/252 (21%)
C01G5.9NP_500991.2 Glyco_transf_92 175..415 CDD:366762 52/251 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.