DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12715 and F36F12.1

DIOPT Version :9

Sequence 1:NP_001285181.1 Gene:CG12715 / 32252 FlyBaseID:FBgn0030443 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_503571.1 Gene:F36F12.1 / 178691 WormBaseID:WBGene00018092 Length:518 Species:Caenorhabditis elegans


Alignment Length:177 Identity:40/177 - (22%)
Similarity:59/177 - (33%) Gaps:46/177 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 YLLYQSLGSLQVLNNPQGTISQPASRPKKVAVVHHGAHPGIDTEGKESAGSQQEPNLEELLRSKE 87
            |.:.:.||.|.::.      :||...||...|......|..::|.:..|.:..:.    ||:.||
 Worm   210 YQMVRELGQLGIVT------TQPWLTPKFSQVARPFLEPSRNSELRNPAAAFTDC----LLQYKE 264

  Fly    88 DVDWVRLRADQCAPYPRYEDIEFP----NPYFQLTRHENLSYYLYGAYYD--------------- 133
                    |.|...:...||:.||    ..|.:..|....||.:...||.               
 Worm   265 --------AAQFIGFMEIEDLLFPLNTLTYYEEFEREYEGSYQISALYYQVVEQQSVKYSSPENQ 321

  Fly   134 ------RRPRIPEMVVLGMATYNGSYPATYLQVWYDGDNQPEKLPVY 174
                  .|.:..|.:.:|.|...   |..|...|.....:.||.|||
 Worm   322 SLGALLTRAQSGETLKMGRAIVR---PERYNSTWAYYSTEAEKHPVY 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12715NP_001285181.1 Glyco_transf_92 240..496 CDD:279961
F36F12.1NP_503571.1 Glyco_transf_92 166..432 CDD:366762 40/177 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.