DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12715 and T15D6.12

DIOPT Version :9

Sequence 1:NP_001285181.1 Gene:CG12715 / 32252 FlyBaseID:FBgn0030443 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_493143.1 Gene:T15D6.12 / 173110 WormBaseID:WBGene00011786 Length:459 Species:Caenorhabditis elegans


Alignment Length:400 Identity:69/400 - (17%)
Similarity:136/400 - (34%) Gaps:110/400 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 DIEFPNPYFQLTRHENLSYYLYGAYYDRRPRIPEMVVLGMATYNGSYPATYLQVWYDGDNQPEKL 171
            |..||..::.:            ||.|.|...|.:.:..:...........:.::|.|.:.|.||
 Worm    44 DSSFPIKFYNV------------AYVDYRYDSPRLRIFTLNHCISKKNFLSVDLYYKGISSPTKL 96

  Fly   172 PVYQSKLGWYKEWGLPEGVVFPTLLTFQMKSQRVPQLVSLVFDPCAVPTNAF-----------KV 225
            .||...|    |...|...:|.                    .||....:.|           ||
 Worm    97 KVYGKSL----EETCPSSYIFA--------------------KPCFYVAHTFFANLELNGRLEKV 137

  Fly   226 VPPPPEEPPN-------AQRPKRIGVCVK----YLRFPDVDMTDRFVEWLELMRLLGATKVTAFD 279
            .....:...|       .:..|.:.:|::    |.::.::      |.::|..|..||::...: 
 Worm   138 TINLGDREVNLAVKEVYKKHEKGLTLCLQPVYYYSQWQNI------VLYIEAWRAHGASRFIVY- 195

  Fly   280 IGLLMPNTRRTLAHYTGAGDGFLDLRKFRFPNETADHETFRAMIIEVLLYNDCLYRNLYDFDFV- 343
            ......:|.:.|.:|...  |.:::|.  :||       |.::..::......:..::|.|.:. 
 Worm   196 YHSATKDTWKVLEYYRDM--GIIEIRP--WPN-------FGSLPPQIEKKYPKIDDSVYGFSYFL 249

  Fly   344 --------------AVVDVDEVIMPLGEHRTWQDLLTHLQVQDVNSTTRSSYCFRNVYFSKQLPV 394
                          :|.|.|||::|   |   ...:.....:::..|...:..|:|.|.|    :
 Worm   250 ALNLCILDIKTTIGSVADFDEVMVP---H---NGTMLEYASKEMTGTNVGALLFKNSYVS----L 304

  Fly   395 DESIPEQFFMLRHVIRVAEHLDPYSAIKCLHDTSYVTLLHNHFPFQWMNA--SDPYHVGIDLGQM 457
            :.||.:..|.   .:.....||..:|.|.:.:.:.:.:...|    |:.:  ....|..:..|.:
 Worm   305 EPSIYDNEFT---GVSKPVFLDGTAAPKYVFNATVIDIAQTH----WVRSFTDSTKHTKVSDGTL 362

  Fly   458 QHYRYTENLK 467
            .|:|:....|
 Worm   363 LHHRFDAKWK 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12715NP_001285181.1 Glyco_transf_92 240..496 CDD:279961 43/248 (17%)
T15D6.12NP_493143.1 Glyco_transf_92 159..395 CDD:366762 43/248 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.