DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12715 and LOC100495391

DIOPT Version :9

Sequence 1:NP_001285181.1 Gene:CG12715 / 32252 FlyBaseID:FBgn0030443 Length:505 Species:Drosophila melanogaster
Sequence 2:XP_002942012.2 Gene:LOC100495391 / 100495391 -ID:- Length:430 Species:Xenopus tropicalis


Alignment Length:443 Identity:107/443 - (24%)
Similarity:175/443 - (39%) Gaps:110/443 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 NPYFQLTRHENLSYYLYGAYYDRRP----RIPEMVVLGMATYNGSYPATYLQVWYDGDNQPE--- 169
            |||    |.:|| ::|.|...|..|    ::.|..:..:..:.....|.|:      ||:..   
 Frog    24 NPY----RWQNL-WHLVGTSMDPLPTCRGQLAEDTITPLKDHRTFIIAPYV------DNRERNII 77

  Fly   170 --------------------KLPVYQSKLG---WYKEWGLPEGVVFPTLLTFQMKSQRVPQLVSL 211
                                |..|.|.|..   ....:|.|.|:.  .::..:....||.. |:|
 Frog    78 RILGIVHTEVKELYCYFCCAKATVLQHKAEIDIHVDRFGFPYGLA--DIICAEPPDCRVAH-VAL 139

  Fly   212 VFDPCAVPTNAFKVVPPPPEEP--PNAQRPKRIGVCVKYLRFPDVDMTDRFVEWLELMRLLGATK 274
            ...|.| ...:..|.|....||  |.|    ...||:..: |.:.....:|::.:|:.::|||.|
 Frog   140 DGSPTA-DFASLTVFPIRNREPGVPTA----NFTVCISAM-FGNYSNVLQFIQTIEMYKILGAQK 198

  Fly   275 VTAFDIGLLMPNTRR----TLAHYTGAG---------DGFLDL-RKFRFPNETADHETFRAMIIE 325
            ||.:     :.|..|    .|.:||..|         ..:|.: ..:::|::..:...:.    :
 Frog   199 VTVY-----LNNCSRQMEEVLQYYTEEGTVEVIPWHIQRYLKVSHNWQYPDDGTEIGYYG----Q 254

  Fly   326 VLLYNDCLYRNLYDFDFVAVVDVDEVIMPLGEHRTWQDLLTHLQVQDVNSTTRSSYCFRNVYFSK 390
            :...|||||||:|...||.:.|.||:|:|. :||||..::..||.::.|.   ..:.|.|..|..
 Frog   255 ISALNDCLYRNMYSSKFVVLNDQDEIILPF-KHRTWDTMMESLQRENPNV---GIFLFENHLFPH 315

  Fly   391 QLPVDESIPEQ--------FFMLRHVIRVAEHLDPYSAIKCLHD------TSYVTLLHNHFPFQW 441
            ....|.:.|:.        |.:|||.:|.....|.:::.|.:.|      ||..::|..:     
 Frog   316 AALTDGNFPDTSRWNGIPGFNLLRHTLREPNRPDHFNSRKMIMDPRAVIQTSVHSVLKQY----- 375

  Fly   442 MNASDPYHVGIDLGQMQHYRYTE----NLKSLVEPPPVRDDNIRRFQHQLIHN 490
               .|...|.::...:.|.|.::    |..||:|     |.||.||...||.|
 Frog   376 ---KDSMFVSLESAMVYHCRDSQQEHLNRSSLIE-----DTNIWRFNETLIRN 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12715NP_001285181.1 Glyco_transf_92 240..496 CDD:279961 73/283 (26%)
LOC100495391XP_002942012.2 Glyco_transf_92 166..420 CDD:396317 72/280 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.