DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12715 and LOC100485657

DIOPT Version :9

Sequence 1:NP_001285181.1 Gene:CG12715 / 32252 FlyBaseID:FBgn0030443 Length:505 Species:Drosophila melanogaster
Sequence 2:XP_002942961.5 Gene:LOC100485657 / 100485657 -ID:- Length:426 Species:Xenopus tropicalis


Alignment Length:434 Identity:90/434 - (20%)
Similarity:162/434 - (37%) Gaps:109/434 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 LTRHENLSYYLYGAYYDRRP--RIPEMVVLGMATYNGSYPATYLQVWYDGDNQPEKLP------V 173
            :|:..:....:..||||.|.  .:..:.:|.:......|      .|:..:|....:|      |
 Frog    47 ITKLPDSKTVIISAYYDDRESNNVRIIAILHVDEVKELY------CWFYCENSNVHVPVRAQIDV 105

  Fly   174 YQSKLGWYKEWGLPEGVVFPTLLTFQMKSQRVPQLVSLVF---------DPCAVPTNAFKVVPPP 229
            :..:.|:             |..|..:..:. |||.|..:         :|...|....|     
 Frog   106 HSDRFGF-------------TYSTVDLLCKE-PQLCSSKYISIQSSGTENPSRGPVFEIK----- 151

  Fly   230 PEEPPNAQRPKRIGVCVKYLRFPDVDMTDRFVEWLELMRLLGATKVTAFD------IGLLMPNTR 288
            ..||.:..  ....||:..: |.:.....:||:.:|:.|:|||.||..:.      ||       
 Frog   152 NREPTSFS--ANFTVCISTM-FGNSSNVLQFVQAIEMYRILGAQKVVVYKNSCSRAIG------- 206

  Fly   289 RTLAHYTGAG---------DGFLDLRKFRFPNETAD---HETFRAMII----EVLLYNDCLYRNL 337
            |.:.:|...|         |.:|         .|:|   |:......|    :|...|||||||:
 Frog   207 RAVDYYVSEGVVEVVPWPIDRYL---------RTSDAWHHDMDPKNEIGYYGQVAALNDCLYRNM 262

  Fly   338 YDFDFVAVVDVDEVIMPLGEHRTWQDLLTHLQVQDVNSTTRSSYCFRNVYFSKQL---PVDESIP 399
            |...::...|:||:|:| ..|..|.:::..||.:..:   :|.:...|.::...|   ..|.:.|
 Frog   263 YKTKYLTFNDIDEIILP-RIHTDWNEMMETLQKEHPD---KSVFLIENHFYPIHLTDHTFDNAFP 323

  Fly   400 EQF---FMLRHVIRVAEHLDPYSAIKCLHDTSYVTLLHNHFPFQWMNASDPYHVGI-----DLGQ 456
            :..   .:|:::....|..:.|:..|.:.:...|..:..||..:       .:.||     .:..
 Frog   324 KDVPGRNILQYIYYEPEQPNVYNNHKMIVNPRKVIQMSVHFSLK-------IYGGILDVANHIAG 381

  Fly   457 MQHYRYTENLKSLVEPPPVRDDNIRRFQHQLIHNSLEVHRQLAQ 500
            :.|.|..:. .:|.....:||..:.::...||.|   |:|.|.:
 Frog   382 LHHSREAKQ-PNLPFTSLIRDTTLWKYNVTLIRN---VNRALGK 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12715NP_001285181.1 Glyco_transf_92 240..496 CDD:279961 64/288 (22%)
LOC100485657XP_002942961.5 Glyco_transf_92 161..414 CDD:396317 62/281 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I4894
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9412
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.