DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12715 and LOC100331417

DIOPT Version :9

Sequence 1:NP_001285181.1 Gene:CG12715 / 32252 FlyBaseID:FBgn0030443 Length:505 Species:Drosophila melanogaster
Sequence 2:XP_021327770.1 Gene:LOC100331417 / 100331417 -ID:- Length:253 Species:Danio rerio


Alignment Length:257 Identity:66/257 - (25%)
Similarity:114/257 - (44%) Gaps:34/257 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 WLELMRLLGATKVTAFDIGLLMPNTRRTLAHYTGAGDGFLD-----LRKFRFPN---ETADHETF 319
            :|..:.|.|.| |.....|   .:..:.|.:|  ..:|.|:     :.||..|:   ...:|:..
Zfish     9 FLSFVNLFGIT-VYKTSCG---KDLEKLLKYY--ESEGILEIVSWPINKFLNPSSGWNFQEHKGD 67

  Fly   320 RAMIIEVLLYNDCLYRNLYDFDFVAVVDVDEVIMPLGEHRTWQDLLTHLQVQDVNSTT--RSSYC 382
            .....:::..|:|:||::|...:|.:.|:||:|||. :|...|.|:.:||.....::.  ..|:.
Zfish    68 LHYYGQLVTLNECIYRHMYQSKYVLLNDIDEIIMPY-KHNNLQALMEYLQSTHPGASVFHVKSHL 131

  Fly   383 FRNVYF--SKQLPVDE--SIPEQFFMLRHVIRVAEHLDPYSAIKCLHDTSYV--TLLHNHFPFQW 441
            |....|  |::....|  :||....| .|:.|..|..:.|:..|.:.:...|  |.:|:...:  
Zfish   132 FPTTQFEESRKFKRKEWNNIPGVNIM-EHIYRAPEPKNVYNPAKMIINPRKVEQTSVHSSLKY-- 193

  Fly   442 MNASDPY-HVGIDLGQMQHYRYT-ENLKSLVEPPPVRDDNIRRFQHQLIHNSLEVHRQLAQS 501
               |..| .|..|:.:|.|.|.. :|..:|.:...:.|..:..|:|:||.|   |.|.|..|
Zfish   194 ---SGYYCFVAFDVSRMIHVREPFQNGANLTKEQLLVDKRVWDFKHELIPN---VDRTLKLS 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12715NP_001285181.1 Glyco_transf_92 240..496 CDD:279961 63/250 (25%)
LOC100331417XP_021327770.1 Glyco_tranf_GTA_type 7..213 CDD:325014 54/216 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.