DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15719 and AT4G02620

DIOPT Version :9

Sequence 1:NP_001259499.1 Gene:CG15719 / 32249 FlyBaseID:FBgn0030440 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_192171.1 Gene:AT4G02620 / 828221 AraportID:AT4G02620 Length:128 Species:Arabidopsis thaliana


Alignment Length:113 Identity:29/113 - (25%)
Similarity:55/113 - (48%) Gaps:12/113 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 NVLRVAIIACPEVTLGFLLCGVGYQKDRFR-NYMMVESETPQEDVEQFFLTVYRRSNIGIVIIDY 112
            |...:|:||..:..:|||:.|||....|.: ||::|:|:|....:|..|.....|.:|.|:::..
plant    11 NSALIAMIADEDTVVGFLMAGVGNVDIRRKTNYLIVDSKTTVRQIEDAFKEFSARDDIAIILLSQ 75

  Fly   113 DTVKRLRTMMQRCSQLLPVLVTVPNKS-----------SLITYLDKKE 149
            .....:|.::...::.:|.::.:|:|.           |.:.||...|
plant    76 YIANMIRFLVDSYNKPVPAILEIPSKDHPYDPAHDSVLSRVKYLFSAE 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15719NP_001259499.1 ATP-synt_F 53..139 CDD:280214 23/86 (27%)
AT4G02620NP_192171.1 ATP-synt_F 9..122 CDD:412487 28/110 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1436
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102324
Panther 1 1.100 - - O PTHR13861
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.